Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A179UI24

Protein Details
Accession A0A179UI24   
Localization Confidence Low
Confidence Score 6
NoLS Segment(s)
PositionSequenceProtein Nature
69-90KITAWKIKYMKYKKLNKDMTKIHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto 11.5, mito 11, cyto_nucl 8, nucl 3.5
Family & Domain DBs
Amino Acid Sequences MDGIIRMEAMSRVKPQQGLGAAGKYAKNKKISDFINLDKPDIFSELEEPLKPEYSEEVTAEAKIAYNIKITAWKIKYMKYKKLNKDMTKI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.26
2 0.26
3 0.29
4 0.28
5 0.29
6 0.27
7 0.24
8 0.22
9 0.23
10 0.24
11 0.25
12 0.29
13 0.29
14 0.34
15 0.34
16 0.36
17 0.42
18 0.41
19 0.41
20 0.41
21 0.38
22 0.41
23 0.4
24 0.38
25 0.31
26 0.3
27 0.23
28 0.2
29 0.17
30 0.09
31 0.1
32 0.1
33 0.11
34 0.1
35 0.11
36 0.1
37 0.11
38 0.11
39 0.1
40 0.1
41 0.12
42 0.13
43 0.12
44 0.14
45 0.14
46 0.14
47 0.14
48 0.11
49 0.09
50 0.09
51 0.1
52 0.08
53 0.09
54 0.09
55 0.1
56 0.15
57 0.17
58 0.25
59 0.25
60 0.32
61 0.33
62 0.4
63 0.51
64 0.53
65 0.62
66 0.63
67 0.72
68 0.75
69 0.83
70 0.86