Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

Q75E12

Protein Details
Accession Q75E12   
Localization Confidence Medium
Confidence Score 11.3
NoLS Segment(s)
PositionSequenceProtein Nature
271-294GKELRVSADKLKKKRRKRSRCTILBasic
NLS Segment(s)
PositionSequence
275-289RVSADKLKKKRRKRS
Subcellular Location(s) nucl 15.5, cyto_nucl 11.833, mito_nucl 10.166, cyto 6, mito 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR027417  P-loop_NTPase  
IPR005225  Small_GTP-bd_dom  
IPR001806  Small_GTPase  
IPR003578  Small_GTPase_Rho  
Gene Ontology GO:0005938  C:cell cortex  
GO:0042995  C:cell projection  
GO:0031410  C:cytoplasmic vesicle  
GO:0005856  C:cytoskeleton  
GO:0012505  C:endomembrane system  
GO:0000329  C:fungal-type vacuole membrane  
GO:0005886  C:plasma membrane  
GO:0005525  F:GTP binding  
GO:0003924  F:GTPase activity  
GO:0019901  F:protein kinase binding  
GO:0007015  P:actin filament organization  
GO:0030865  P:cortical cytoskeleton organization  
GO:0007163  P:establishment or maintenance of cell polarity  
GO:0032956  P:regulation of actin cytoskeleton organization  
GO:0008360  P:regulation of cell shape  
GO:0007264  P:small GTPase mediated signal transduction  
KEGG ago:AGOS_ABL139C  -  
Pfam View protein in Pfam  
PF00071  Ras  
PROSITE View protein in PROSITE  
PS51419  RAB  
PS51421  RAS  
PS51420  RHO  
CDD cd00157  Rho  
Amino Acid Sequences MCFSQSGRLSAQAADTMRSIKCVVIGDGAVGKTSLLISYTTNSFPQDYIPTVFDNYSTTIAVQDPASSTGEQQLFKLNLWDTAGQEEYDRLRPLSYPQTDIFLICFSINEPVSFQNIRDKWFPEIKHNTNYENMELFLECGKYPILLVGTKADLRDDDHEEDRLREMNTDFVSQAEIERVVQDCGFMGYVECSAATQEGVREVFERAVKYVVYEPDRLMNRSKNMSILVNSPLPLDSYANEDASNPKNKGGDPSAGSGPLKKAVGDDGAHGKELRVSADKLKKKRRKRSRCTIL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.2
2 0.2
3 0.2
4 0.19
5 0.21
6 0.2
7 0.15
8 0.17
9 0.18
10 0.18
11 0.16
12 0.16
13 0.15
14 0.18
15 0.17
16 0.14
17 0.12
18 0.11
19 0.09
20 0.09
21 0.08
22 0.06
23 0.07
24 0.08
25 0.11
26 0.14
27 0.15
28 0.16
29 0.17
30 0.18
31 0.17
32 0.18
33 0.19
34 0.19
35 0.2
36 0.2
37 0.2
38 0.2
39 0.2
40 0.18
41 0.17
42 0.16
43 0.15
44 0.14
45 0.12
46 0.12
47 0.12
48 0.13
49 0.11
50 0.1
51 0.09
52 0.11
53 0.13
54 0.12
55 0.12
56 0.17
57 0.2
58 0.2
59 0.19
60 0.23
61 0.22
62 0.22
63 0.25
64 0.19
65 0.18
66 0.19
67 0.2
68 0.15
69 0.16
70 0.17
71 0.13
72 0.13
73 0.13
74 0.14
75 0.16
76 0.17
77 0.15
78 0.14
79 0.15
80 0.19
81 0.26
82 0.25
83 0.26
84 0.25
85 0.28
86 0.27
87 0.27
88 0.23
89 0.15
90 0.13
91 0.09
92 0.09
93 0.06
94 0.1
95 0.1
96 0.09
97 0.1
98 0.1
99 0.14
100 0.14
101 0.14
102 0.19
103 0.2
104 0.23
105 0.25
106 0.26
107 0.27
108 0.32
109 0.33
110 0.33
111 0.41
112 0.42
113 0.46
114 0.46
115 0.43
116 0.41
117 0.42
118 0.33
119 0.25
120 0.21
121 0.15
122 0.13
123 0.12
124 0.09
125 0.08
126 0.07
127 0.07
128 0.06
129 0.06
130 0.06
131 0.06
132 0.06
133 0.06
134 0.07
135 0.07
136 0.08
137 0.09
138 0.09
139 0.08
140 0.07
141 0.09
142 0.11
143 0.14
144 0.16
145 0.16
146 0.19
147 0.19
148 0.19
149 0.19
150 0.18
151 0.14
152 0.13
153 0.12
154 0.14
155 0.14
156 0.15
157 0.14
158 0.12
159 0.12
160 0.1
161 0.1
162 0.08
163 0.07
164 0.06
165 0.07
166 0.08
167 0.08
168 0.07
169 0.07
170 0.06
171 0.07
172 0.07
173 0.06
174 0.05
175 0.05
176 0.05
177 0.05
178 0.05
179 0.04
180 0.05
181 0.05
182 0.05
183 0.05
184 0.05
185 0.07
186 0.08
187 0.08
188 0.09
189 0.1
190 0.12
191 0.14
192 0.14
193 0.13
194 0.14
195 0.13
196 0.14
197 0.17
198 0.2
199 0.21
200 0.22
201 0.22
202 0.27
203 0.3
204 0.3
205 0.31
206 0.31
207 0.33
208 0.36
209 0.36
210 0.31
211 0.31
212 0.32
213 0.28
214 0.26
215 0.25
216 0.22
217 0.21
218 0.19
219 0.17
220 0.16
221 0.15
222 0.14
223 0.1
224 0.14
225 0.16
226 0.16
227 0.16
228 0.16
229 0.19
230 0.24
231 0.31
232 0.26
233 0.27
234 0.29
235 0.3
236 0.36
237 0.35
238 0.35
239 0.31
240 0.34
241 0.33
242 0.34
243 0.34
244 0.3
245 0.28
246 0.26
247 0.24
248 0.2
249 0.19
250 0.18
251 0.22
252 0.2
253 0.22
254 0.25
255 0.26
256 0.27
257 0.26
258 0.24
259 0.23
260 0.23
261 0.23
262 0.2
263 0.21
264 0.3
265 0.4
266 0.48
267 0.56
268 0.66
269 0.73
270 0.79
271 0.88
272 0.9
273 0.91
274 0.93