Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A179USR4

Protein Details
Accession A0A179USR4    Localization Confidence Medium Confidence Score 12
NoLS Segment(s)
PositionSequenceProtein Nature
96-120SRTRTNPRKLSAHRKRPPTSPKCSLHydrophilic
NLS Segment(s)
PositionSequence
75-82PRKPWKRA
101-112NPRKLSAHRKRP
Subcellular Location(s) mito 18, nucl 5, cyto 2
Family & Domain DBs
Amino Acid Sequences MESTNAFFLLRMKKAPIWHRGFLQEPQLRTPPSLCIRDTRCPPHLVPDVPLLGTAILNCRGRVTITTARQNVKSPRKPWKRAPGSPIFPTLVKVFSRTRTNPRKLSAHRKRPPTSPKCSLLI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.38
2 0.45
3 0.5
4 0.5
5 0.5
6 0.51
7 0.52
8 0.52
9 0.47
10 0.5
11 0.44
12 0.39
13 0.4
14 0.41
15 0.38
16 0.35
17 0.33
18 0.3
19 0.32
20 0.34
21 0.31
22 0.33
23 0.38
24 0.44
25 0.49
26 0.48
27 0.46
28 0.46
29 0.45
30 0.45
31 0.45
32 0.38
33 0.34
34 0.3
35 0.27
36 0.24
37 0.23
38 0.16
39 0.1
40 0.09
41 0.07
42 0.06
43 0.1
44 0.1
45 0.1
46 0.1
47 0.1
48 0.11
49 0.12
50 0.16
51 0.19
52 0.23
53 0.3
54 0.33
55 0.35
56 0.36
57 0.4
58 0.43
59 0.47
60 0.5
61 0.49
62 0.57
63 0.65
64 0.71
65 0.76
66 0.78
67 0.77
68 0.76
69 0.78
70 0.77
71 0.72
72 0.67
73 0.61
74 0.52
75 0.42
76 0.38
77 0.31
78 0.25
79 0.19
80 0.21
81 0.21
82 0.25
83 0.33
84 0.36
85 0.46
86 0.53
87 0.61
88 0.64
89 0.67
90 0.71
91 0.72
92 0.78
93 0.79
94 0.8
95 0.8
96 0.83
97 0.82
98 0.82
99 0.84
100 0.82
101 0.8
102 0.77