Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5Q4BE01

Protein Details
Accession A0A5Q4BE01    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
48-77ARAEKPSKTRSAKSPKKTKPSKTRDPGSIIHydrophilic
NLS Segment(s)
PositionSequence
48-71ARAEKPSKTRSAKSPKKTKPSKTR
Subcellular Location(s) extr 24, golg 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR004898  Pectate_lyase_PlyH/PlyE-like  
IPR012334  Pectin_lyas_fold  
IPR011050  Pectin_lyase_fold/virulence  
Gene Ontology GO:0005576  C:extracellular region  
GO:0030570  F:pectate lyase activity  
Pfam View protein in Pfam  
PF03211  Pectate_lyase  
Amino Acid Sequences MKYSFAVALGTLVLGIAAAPAANDAANSNGNGIAHAERGYFDFLRHAARAEKPSKTRSAKSPKKTKPSKTRDPGSIITSAPGAPGAPGNATDSFAIRASNGTAPAPGGGLPASSGTSVLKAAQTVAAGESFDGGMVAFDRGVSCTGQAEGGDSDAVFILEKGAKLSNVIIGPNQIEGVHCNGGCALANVWWSAVCEDAFTIKLQDAGETTTITGGGAFGADDKVLQHNGAGTLSVTGFTVETFGKLYRSCGNCKTSAERHVIFDNVSASSGKLLAGINSNFGDTATFKNVVAKGVKEVCTEFKGTTPGNEPSEVSSGPSTACIYSTSDVASS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.04
2 0.03
3 0.03
4 0.03
5 0.03
6 0.03
7 0.03
8 0.04
9 0.04
10 0.04
11 0.05
12 0.08
13 0.09
14 0.1
15 0.1
16 0.11
17 0.11
18 0.11
19 0.13
20 0.12
21 0.12
22 0.12
23 0.12
24 0.11
25 0.13
26 0.17
27 0.15
28 0.15
29 0.17
30 0.18
31 0.21
32 0.21
33 0.22
34 0.22
35 0.27
36 0.35
37 0.37
38 0.44
39 0.45
40 0.51
41 0.58
42 0.6
43 0.6
44 0.62
45 0.68
46 0.7
47 0.75
48 0.81
49 0.81
50 0.85
51 0.89
52 0.89
53 0.89
54 0.89
55 0.9
56 0.88
57 0.86
58 0.82
59 0.78
60 0.71
61 0.63
62 0.56
63 0.45
64 0.36
65 0.29
66 0.22
67 0.16
68 0.12
69 0.09
70 0.06
71 0.07
72 0.07
73 0.06
74 0.07
75 0.09
76 0.1
77 0.11
78 0.11
79 0.11
80 0.12
81 0.11
82 0.11
83 0.08
84 0.09
85 0.1
86 0.11
87 0.11
88 0.1
89 0.1
90 0.1
91 0.1
92 0.1
93 0.07
94 0.06
95 0.05
96 0.05
97 0.05
98 0.05
99 0.06
100 0.05
101 0.06
102 0.05
103 0.06
104 0.06
105 0.07
106 0.07
107 0.06
108 0.07
109 0.07
110 0.07
111 0.06
112 0.07
113 0.06
114 0.06
115 0.05
116 0.05
117 0.04
118 0.04
119 0.04
120 0.03
121 0.03
122 0.03
123 0.04
124 0.03
125 0.03
126 0.04
127 0.04
128 0.05
129 0.05
130 0.05
131 0.06
132 0.06
133 0.06
134 0.06
135 0.06
136 0.06
137 0.06
138 0.06
139 0.05
140 0.05
141 0.04
142 0.05
143 0.03
144 0.03
145 0.04
146 0.05
147 0.05
148 0.06
149 0.06
150 0.06
151 0.07
152 0.07
153 0.09
154 0.08
155 0.09
156 0.08
157 0.08
158 0.09
159 0.08
160 0.08
161 0.06
162 0.05
163 0.06
164 0.09
165 0.1
166 0.09
167 0.09
168 0.09
169 0.09
170 0.09
171 0.08
172 0.06
173 0.05
174 0.06
175 0.06
176 0.06
177 0.06
178 0.06
179 0.06
180 0.06
181 0.05
182 0.05
183 0.05
184 0.06
185 0.07
186 0.06
187 0.07
188 0.06
189 0.08
190 0.08
191 0.08
192 0.08
193 0.09
194 0.09
195 0.09
196 0.09
197 0.07
198 0.07
199 0.06
200 0.05
201 0.04
202 0.03
203 0.03
204 0.03
205 0.03
206 0.03
207 0.03
208 0.04
209 0.04
210 0.06
211 0.07
212 0.07
213 0.07
214 0.08
215 0.08
216 0.08
217 0.08
218 0.06
219 0.06
220 0.06
221 0.07
222 0.06
223 0.05
224 0.05
225 0.05
226 0.07
227 0.06
228 0.06
229 0.08
230 0.08
231 0.1
232 0.1
233 0.13
234 0.19
235 0.23
236 0.27
237 0.32
238 0.36
239 0.37
240 0.41
241 0.45
242 0.44
243 0.46
244 0.48
245 0.43
246 0.42
247 0.41
248 0.39
249 0.31
250 0.27
251 0.23
252 0.16
253 0.16
254 0.13
255 0.11
256 0.1
257 0.1
258 0.08
259 0.09
260 0.08
261 0.09
262 0.14
263 0.14
264 0.16
265 0.16
266 0.16
267 0.15
268 0.14
269 0.14
270 0.11
271 0.14
272 0.16
273 0.17
274 0.16
275 0.22
276 0.23
277 0.26
278 0.27
279 0.25
280 0.27
281 0.32
282 0.34
283 0.31
284 0.32
285 0.33
286 0.33
287 0.34
288 0.28
289 0.25
290 0.28
291 0.27
292 0.28
293 0.29
294 0.32
295 0.33
296 0.33
297 0.32
298 0.3
299 0.33
300 0.29
301 0.26
302 0.21
303 0.19
304 0.17
305 0.19
306 0.17
307 0.13
308 0.14
309 0.12
310 0.15
311 0.16
312 0.17