Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A5N7ACV8

Protein Details
Accession A0A5N7ACV8    Localization Confidence Medium Confidence Score 13.8
NoLS Segment(s)
PositionSequenceProtein Nature
5-31PTKARQACGACKKHKRKCDKVLPVCGLHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 22, mito 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR036864  Zn2-C6_fun-type_DNA-bd_sf  
IPR001138  Zn2Cys6_DnaBD  
Gene Ontology GO:0005634  C:nucleus  
GO:0003677  F:DNA binding  
GO:0000981  F:DNA-binding transcription factor activity, RNA polymerase II-specific  
GO:0008270  F:zinc ion binding  
Pfam View protein in Pfam  
PF00172  Zn_clus  
PROSITE View protein in PROSITE  
PS00463  ZN2_CY6_FUNGAL_1  
PS50048  ZN2_CY6_FUNGAL_2  
CDD cd00067  GAL4  
Amino Acid Sequences MERLPTKARQACGACKKHKRKCDKVLPVCGLCARTERACEYGESPKPSPSAEEFAAL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.64
2 0.69
3 0.78
4 0.79
5 0.84
6 0.84
7 0.84
8 0.85
9 0.87
10 0.87
11 0.85
12 0.84
13 0.8
14 0.7
15 0.6
16 0.51
17 0.4
18 0.3
19 0.24
20 0.18
21 0.14
22 0.16
23 0.17
24 0.18
25 0.18
26 0.19
27 0.2
28 0.26
29 0.31
30 0.35
31 0.34
32 0.35
33 0.35
34 0.35
35 0.35
36 0.31
37 0.31