Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A179UNV2

Protein Details
Accession A0A179UNV2   
Localization Confidence Low
Confidence Score 6.1
NoLS Segment(s)
PositionSequenceProtein Nature
30-49QLYRRLLRVHRKKLPKDMRLBasic
NLS Segment(s)
Subcellular Location(s) mito 21.5, cyto_mito 12, nucl 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR008381  SDHAF3/Sdh7  
Gene Ontology GO:0005759  C:mitochondrial matrix  
GO:0006094  P:gluconeogenesis  
GO:0034553  P:mitochondrial respiratory chain complex II assembly  
Pfam View protein in Pfam  
PF13233  Complex1_LYR_2  
CDD cd20270  Complex1_LYR_SDHAF3_LYRM10  
Amino Acid Sequences MRVSPRLLMANPLPMAVNSRQLSALLPPLQLYRRLLRVHRKKLPKDMRLLGDEYVKSEFRAHRNVDNPIHIVGFLTEWQLYAQKLEGDAWQGEKLDKAKIDKMSDQQIGQLYELMTALKGKNED
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.2
2 0.24
3 0.2
4 0.27
5 0.21
6 0.22
7 0.22
8 0.22
9 0.22
10 0.19
11 0.24
12 0.17
13 0.17
14 0.16
15 0.19
16 0.2
17 0.23
18 0.24
19 0.22
20 0.26
21 0.29
22 0.35
23 0.43
24 0.52
25 0.59
26 0.65
27 0.71
28 0.71
29 0.78
30 0.82
31 0.77
32 0.74
33 0.69
34 0.64
35 0.57
36 0.53
37 0.43
38 0.36
39 0.3
40 0.24
41 0.2
42 0.16
43 0.14
44 0.16
45 0.18
46 0.18
47 0.24
48 0.25
49 0.27
50 0.3
51 0.35
52 0.34
53 0.32
54 0.3
55 0.24
56 0.22
57 0.17
58 0.14
59 0.09
60 0.08
61 0.06
62 0.06
63 0.05
64 0.06
65 0.06
66 0.08
67 0.07
68 0.08
69 0.08
70 0.07
71 0.08
72 0.09
73 0.09
74 0.1
75 0.11
76 0.12
77 0.12
78 0.12
79 0.12
80 0.14
81 0.15
82 0.16
83 0.18
84 0.21
85 0.25
86 0.3
87 0.34
88 0.36
89 0.4
90 0.44
91 0.44
92 0.41
93 0.38
94 0.37
95 0.34
96 0.3
97 0.26
98 0.19
99 0.16
100 0.16
101 0.13
102 0.1
103 0.11
104 0.11