Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A179UDQ3

Protein Details
Accession A0A179UDQ3   
Localization Confidence Medium
Confidence Score 12.7
NoLS Segment(s)
PositionSequenceProtein Nature
97-121GPKGHYPEKRTEKHRCKDSQAGKSNBasic
NLS Segment(s)
PositionSequence
126-129EKKK
Subcellular Location(s) nucl 18.5, cyto_nucl 14, cyto 6.5
Family & Domain DBs
KEGG bgh:BDBG_01163  -  
PROSITE View protein in PROSITE  
PS51257  PROKAR_LIPOPROTEIN  
Amino Acid Sequences MSTPHKRTGYQQSENGILQSGMYACPSAYLVYPPDPTGRRPSQHALLQYVSPEDRRNHDNLRLIQEQLYNDANSSRNTQRSGGANEGYRTILNEPSGPKGHYPEKRTEKHRCKDSQAGKSNDKTPEKKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.54
2 0.47
3 0.36
4 0.26
5 0.19
6 0.15
7 0.12
8 0.08
9 0.08
10 0.07
11 0.06
12 0.07
13 0.08
14 0.07
15 0.07
16 0.09
17 0.11
18 0.13
19 0.15
20 0.15
21 0.2
22 0.21
23 0.23
24 0.29
25 0.32
26 0.32
27 0.36
28 0.4
29 0.41
30 0.43
31 0.43
32 0.38
33 0.33
34 0.31
35 0.27
36 0.23
37 0.18
38 0.16
39 0.17
40 0.16
41 0.18
42 0.2
43 0.24
44 0.26
45 0.3
46 0.35
47 0.33
48 0.38
49 0.36
50 0.34
51 0.31
52 0.29
53 0.25
54 0.21
55 0.19
56 0.13
57 0.12
58 0.13
59 0.13
60 0.12
61 0.17
62 0.17
63 0.19
64 0.21
65 0.22
66 0.24
67 0.26
68 0.29
69 0.27
70 0.26
71 0.26
72 0.24
73 0.24
74 0.22
75 0.18
76 0.16
77 0.14
78 0.13
79 0.12
80 0.15
81 0.15
82 0.19
83 0.21
84 0.21
85 0.21
86 0.25
87 0.33
88 0.37
89 0.4
90 0.46
91 0.54
92 0.6
93 0.67
94 0.73
95 0.75
96 0.78
97 0.83
98 0.79
99 0.77
100 0.8
101 0.81
102 0.81
103 0.8
104 0.78
105 0.75
106 0.74
107 0.73
108 0.72
109 0.71