Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A5N7A2R6

Protein Details
Accession A0A5N7A2R6    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
18-37AKRGKGKSATKQKQNSKSPVHydrophilic
NLS Segment(s)
PositionSequence
11-29KFAKSEAAKRGKGKSATKQ
Subcellular Location(s) plas 13, mito 6, E.R. 5, cyto 1, pero 1, vacu 1, cyto_pero 1
Family & Domain DBs
InterPro View protein in InterPro  
IPR010580  ER_stress-assoc  
Gene Ontology GO:0005789  C:endoplasmic reticulum membrane  
GO:0015031  P:protein transport  
Pfam View protein in Pfam  
PF06624  RAMP4  
Amino Acid Sequences MTPQQRKANEKFAKSEAAKRGKGKSATKQKQNSKSPVSAGWVVVLAFAVCGGLAFEALRIIPELWSAAVAMFNRKLV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.54
2 0.56
3 0.54
4 0.55
5 0.56
6 0.55
7 0.57
8 0.55
9 0.59
10 0.58
11 0.59
12 0.62
13 0.66
14 0.71
15 0.75
16 0.77
17 0.8
18 0.81
19 0.78
20 0.71
21 0.65
22 0.57
23 0.49
24 0.42
25 0.33
26 0.26
27 0.19
28 0.14
29 0.11
30 0.1
31 0.08
32 0.05
33 0.03
34 0.03
35 0.03
36 0.02
37 0.02
38 0.02
39 0.02
40 0.03
41 0.03
42 0.03
43 0.03
44 0.04
45 0.04
46 0.05
47 0.06
48 0.06
49 0.06
50 0.07
51 0.07
52 0.07
53 0.07
54 0.06
55 0.09
56 0.1
57 0.14