Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5N6ZMF5

Protein Details
Accession A0A5N6ZMF5   
Localization Confidence Low
Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
1-26MPPYAVRTQLKRKRKKYEPWLRLSAAHydrophilic
NLS Segment(s)
PositionSequence
11-16KRKRKK
Subcellular Location(s) mito 19.5, mito_nucl 11.833, cyto_nucl 3.833, cyto 3.5
Family & Domain DBs
Amino Acid Sequences MPPYAVRTQLKRKRKKYEPWLRLSAAPTVRKQPYHKRSYCLAGSDFSRFCLVVVINQPGLHSLIEYIKGSHPAWVSHFVRNDYYAICWM
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.86
2 0.89
3 0.89
4 0.91
5 0.9
6 0.87
7 0.84
8 0.76
9 0.69
10 0.6
11 0.55
12 0.5
13 0.44
14 0.38
15 0.39
16 0.39
17 0.4
18 0.45
19 0.5
20 0.53
21 0.59
22 0.6
23 0.57
24 0.57
25 0.58
26 0.53
27 0.45
28 0.36
29 0.27
30 0.26
31 0.25
32 0.21
33 0.17
34 0.16
35 0.13
36 0.11
37 0.12
38 0.1
39 0.1
40 0.13
41 0.14
42 0.14
43 0.14
44 0.14
45 0.13
46 0.14
47 0.11
48 0.08
49 0.07
50 0.08
51 0.1
52 0.11
53 0.12
54 0.12
55 0.16
56 0.16
57 0.19
58 0.19
59 0.19
60 0.22
61 0.29
62 0.3
63 0.32
64 0.36
65 0.35
66 0.36
67 0.36
68 0.34
69 0.27