Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

Q757L6

Protein Details
Accession Q757L6    Localization Confidence Medium Confidence Score 14.2
NoLS Segment(s)
PositionSequenceProtein Nature
75-103LESLPSSRSRKRRSKEKRDPNLPKRPTNAHydrophilic
NLS Segment(s)
PositionSequence
82-99RSRKRRSKEKRDPNLPKR
Subcellular Location(s) nucl 24, cyto_nucl 14.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR009071  HMG_box_dom  
IPR036910  HMG_box_dom_sf  
Gene Ontology GO:0031011  C:Ino80 complex  
GO:0045027  F:DNA end binding  
GO:0000404  F:heteroduplex DNA loop binding  
GO:0006338  P:chromatin remodeling  
GO:0006302  P:double-strand break repair  
GO:0000722  P:telomere maintenance via recombination  
KEGG ago:AGOS_AEL005C  -  
Pfam View protein in Pfam  
PF00505  HMG_box  
PROSITE View protein in PROSITE  
PS50118  HMG_BOX_2  
Amino Acid Sequences MVDQNNKDLALAIKELTEQNDTLSLAIQRTRLSVKRLRLEYAVLLERLEARIEKDPSLHYEEPLPTLASFKNNLLESLPSSRSRKRRSKEKRDPNLPKRPTNAYLLFCEMNKDKIRHEHAANNVDMTKVLPEIWKNMDEEAKKPYYDLYNADRLRYQREMTAYSQNKTTEEANVDVKNESGNEEEEGDEPEHEPDADEIDVNDSDVTQLDDGIGDVASSVMSSEM
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.16
2 0.17
3 0.18
4 0.19
5 0.16
6 0.15
7 0.17
8 0.17
9 0.15
10 0.16
11 0.15
12 0.14
13 0.16
14 0.16
15 0.15
16 0.17
17 0.23
18 0.25
19 0.31
20 0.36
21 0.42
22 0.49
23 0.52
24 0.52
25 0.48
26 0.46
27 0.41
28 0.4
29 0.34
30 0.25
31 0.23
32 0.2
33 0.19
34 0.17
35 0.16
36 0.11
37 0.11
38 0.18
39 0.2
40 0.2
41 0.21
42 0.22
43 0.25
44 0.33
45 0.31
46 0.24
47 0.27
48 0.27
49 0.27
50 0.26
51 0.23
52 0.14
53 0.16
54 0.16
55 0.14
56 0.15
57 0.14
58 0.17
59 0.17
60 0.17
61 0.16
62 0.16
63 0.16
64 0.19
65 0.21
66 0.21
67 0.25
68 0.31
69 0.39
70 0.48
71 0.55
72 0.59
73 0.67
74 0.74
75 0.82
76 0.86
77 0.88
78 0.89
79 0.91
80 0.94
81 0.93
82 0.92
83 0.87
84 0.8
85 0.73
86 0.67
87 0.59
88 0.54
89 0.48
90 0.39
91 0.35
92 0.33
93 0.29
94 0.24
95 0.24
96 0.19
97 0.19
98 0.21
99 0.2
100 0.19
101 0.25
102 0.3
103 0.32
104 0.33
105 0.33
106 0.36
107 0.39
108 0.37
109 0.31
110 0.26
111 0.22
112 0.2
113 0.15
114 0.1
115 0.06
116 0.06
117 0.07
118 0.07
119 0.1
120 0.12
121 0.13
122 0.13
123 0.14
124 0.19
125 0.18
126 0.19
127 0.22
128 0.22
129 0.2
130 0.2
131 0.21
132 0.19
133 0.19
134 0.22
135 0.21
136 0.29
137 0.29
138 0.3
139 0.31
140 0.3
141 0.33
142 0.32
143 0.29
144 0.23
145 0.25
146 0.28
147 0.28
148 0.37
149 0.35
150 0.33
151 0.36
152 0.34
153 0.32
154 0.3
155 0.28
156 0.21
157 0.21
158 0.22
159 0.23
160 0.23
161 0.23
162 0.21
163 0.2
164 0.18
165 0.15
166 0.14
167 0.11
168 0.12
169 0.11
170 0.12
171 0.13
172 0.13
173 0.15
174 0.14
175 0.13
176 0.13
177 0.13
178 0.12
179 0.11
180 0.11
181 0.09
182 0.11
183 0.1
184 0.1
185 0.09
186 0.12
187 0.12
188 0.11
189 0.11
190 0.08
191 0.08
192 0.09
193 0.1
194 0.07
195 0.07
196 0.06
197 0.07
198 0.07
199 0.07
200 0.06
201 0.04
202 0.04
203 0.04
204 0.04
205 0.04