Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A179UZU8

Protein Details
Accession A0A179UZU8    Localization Confidence Medium Confidence Score 14.5
NoLS Segment(s)
PositionSequenceProtein Nature
1-21MAPRKRIKKHPLPPSHHTKCPBasic
NLS Segment(s)
PositionSequence
6-6R
8-8K
Subcellular Location(s) nucl 15.5, cyto_nucl 11, mito 8
Family & Domain DBs
Amino Acid Sequences MAPRKRIKKHPLPPSHHTKCPPFHSSSEWVEALTTQQESLNLNLRQSLDTCHGKQEHQASNPISKLFLTRFPLSLRNLVAS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.85
2 0.82
3 0.78
4 0.73
5 0.7
6 0.66
7 0.65
8 0.63
9 0.56
10 0.51
11 0.49
12 0.49
13 0.45
14 0.41
15 0.34
16 0.29
17 0.24
18 0.22
19 0.17
20 0.13
21 0.1
22 0.06
23 0.06
24 0.07
25 0.08
26 0.09
27 0.16
28 0.15
29 0.15
30 0.16
31 0.17
32 0.16
33 0.16
34 0.17
35 0.16
36 0.2
37 0.21
38 0.24
39 0.25
40 0.25
41 0.29
42 0.35
43 0.36
44 0.33
45 0.39
46 0.36
47 0.4
48 0.41
49 0.37
50 0.29
51 0.23
52 0.24
53 0.21
54 0.25
55 0.26
56 0.26
57 0.28
58 0.31
59 0.36
60 0.37
61 0.39