Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A179UGV1

Protein Details
Accession A0A179UGV1   
Localization Confidence Medium
Confidence Score 10.7
NoLS Segment(s)
PositionSequenceProtein Nature
86-112KLLLSRGKGSRKKKNYYKKLQKLAAEIHydrophilic
NLS Segment(s)
PositionSequence
64-71KLRKLKKL
89-100LSRGKGSRKKKN
Subcellular Location(s) cyto 19.5, cyto_nucl 11.5, pero 3, nucl 2.5
Family & Domain DBs
Amino Acid Sequences MSEIPDNVLEQGSDATEKWLKKHKGHSKAITARWWDDVWSVTKCAGAIAYFIVENYAVIAKLGKLRKLKKLKETIDEVGGYKNAAKLLLSRGKGSRKKKNYYKKLQKLAAEIIGLAIIDSYCT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.09
2 0.13
3 0.17
4 0.18
5 0.22
6 0.31
7 0.37
8 0.42
9 0.53
10 0.59
11 0.64
12 0.73
13 0.75
14 0.76
15 0.77
16 0.76
17 0.71
18 0.65
19 0.56
20 0.49
21 0.42
22 0.33
23 0.26
24 0.23
25 0.2
26 0.18
27 0.17
28 0.14
29 0.15
30 0.14
31 0.13
32 0.11
33 0.07
34 0.06
35 0.05
36 0.06
37 0.05
38 0.05
39 0.05
40 0.04
41 0.04
42 0.04
43 0.04
44 0.03
45 0.04
46 0.04
47 0.04
48 0.1
49 0.11
50 0.16
51 0.22
52 0.26
53 0.36
54 0.46
55 0.51
56 0.55
57 0.63
58 0.62
59 0.61
60 0.63
61 0.55
62 0.48
63 0.43
64 0.35
65 0.26
66 0.22
67 0.17
68 0.12
69 0.11
70 0.09
71 0.08
72 0.08
73 0.08
74 0.16
75 0.22
76 0.23
77 0.24
78 0.29
79 0.39
80 0.48
81 0.55
82 0.59
83 0.62
84 0.71
85 0.79
86 0.85
87 0.86
88 0.89
89 0.92
90 0.91
91 0.92
92 0.88
93 0.82
94 0.77
95 0.71
96 0.62
97 0.51
98 0.4
99 0.3
100 0.23
101 0.18
102 0.13
103 0.08