FuNGI

A0A179V271

Protein Details

Accession

A0A179V271

Localization Confidence

Low

Confidence Score

NoLS Segment(s)

Position	Sequence	Protein Nature
55-86	GPKFRESRSARINKKTKREKPRPPAVGERRAA	Basic

NLS Segment(s)

Position	Sequence
44-87	MKKKPGSGRSEGPKFRESRSARINKKTKREKPRPPAVGERRAAR

Subcellular Location(s)

mito 23.5, cyto_mito 13

Family & Domain DBs

InterPro	View protein in InterPro IPR019368 Ribosomal_S23/S29_mit
Gene Ontology	GO:0005739 C:mitochondrion GO:1990904 C:ribonucleoprotein complex GO:0005840 C:ribosome
KEGG	bgh:BDBG_08020 -
Pfam	View protein in Pfam PF10236 DAP3

Amino Acid Sequences

MASSSFCWGCFSKLRLSAPRLLQPPSVLRIAPFHTTAPALALPMKKKPGSGRSEGPKFRESRSARINKKTKREKPRPPAVGERRAARQRIVLSNTNALEVPDMQELSIENMTNAELRGRIVGLPMALVDRLRGARAFKTTQGWSLFRRPGTLVREETLELGRLIGGIGNGESEMKGKTVKRIITGDKGTGKSVHLTQAMTLAMLNNWVTVTIPEAQDLTIAHTAYAPSTTEPGQYVQKDAVAALLQRMVTANGPVLAKLHISQDHPNLKAPFRPEMNLEQLAKLGIDDTAHAWSVFQALWSELTATKATADAEGLKPFASRPPILVTVDGLAHWMANSKYRTAEYEVIHAHDLALVNHFLSLLSSDRSSPTLPNGGLLLYSTSTSNTPNIYTFDILLKQLAARTSGIPADSPEFPTADPYRRPDSRVLALLDDAKDLTTQRLTGLGKKDSKGLLEYFALSGILREKVTEEFVSEKWTLSGMGIVGELEKLGKRVRVPPPIPMPAAN

FASTA Sequence
with NoLS information

AlphaFold Structure
with highlighted NoLS

NoLS Predictions per Residue

Residue Number	Score
1	0.48
2	0.52
3	0.57
4	0.6
5	0.59
6	0.64
7	0.6
8	0.56
9	0.51
10	0.47
11	0.47
12	0.43
13	0.39
14	0.32
15	0.29
16	0.3
17	0.31
18	0.3
19	0.27
20	0.24
21	0.23
22	0.23
23	0.22
24	0.21
25	0.17
26	0.15
27	0.18
28	0.22
29	0.24
30	0.3
31	0.37
32	0.35
33	0.39
34	0.46
35	0.51
36	0.53
37	0.56
38	0.59
39	0.62
40	0.71
41	0.72
42	0.69
43	0.67
44	0.62
45	0.59
46	0.6
47	0.54
48	0.53
49	0.59
50	0.64
51	0.65
52	0.73
53	0.79
54	0.78
55	0.85
56	0.87
57	0.86
58	0.87
59	0.9
60	0.9
61	0.91
62	0.93
63	0.9
64	0.85
65	0.86
66	0.85
67	0.83
68	0.76
69	0.7
70	0.68
71	0.67
72	0.63
73	0.54
74	0.5
75	0.46
76	0.49
77	0.5
78	0.47
79	0.43
80	0.47
81	0.45
82	0.41
83	0.35
84	0.28
85	0.23
86	0.17
87	0.17
88	0.12
89	0.12
90	0.1
91	0.11
92	0.11
93	0.13
94	0.14
95	0.11
96	0.09
97	0.1
98	0.1
99	0.11
100	0.11
101	0.08
102	0.07
103	0.08
104	0.09
105	0.09
106	0.09
107	0.09
108	0.09
109	0.08
110	0.08
111	0.07
112	0.07
113	0.07
114	0.07
115	0.06
116	0.08
117	0.09
118	0.1
119	0.11
120	0.13
121	0.16
122	0.21
123	0.23
124	0.24
125	0.28
126	0.29
127	0.32
128	0.35
129	0.34
130	0.33
131	0.39
132	0.41
133	0.36
134	0.37
135	0.33
136	0.35
137	0.37
138	0.39
139	0.33
140	0.29
141	0.31
142	0.29
143	0.28
144	0.22
145	0.19
146	0.13
147	0.11
148	0.1
149	0.08
150	0.07
151	0.06
152	0.05
153	0.04
154	0.04
155	0.04
156	0.04
157	0.04
158	0.05
159	0.05
160	0.05
161	0.06
162	0.1
163	0.11
164	0.16
165	0.22
166	0.23
167	0.26
168	0.31
169	0.34
170	0.38
171	0.39
172	0.38
173	0.37
174	0.37
175	0.34
176	0.3
177	0.27
178	0.22
179	0.21
180	0.21
181	0.17
182	0.16
183	0.15
184	0.16
185	0.15
186	0.13
187	0.12
188	0.08
189	0.06
190	0.07
191	0.07
192	0.05
193	0.05
194	0.05
195	0.05
196	0.04
197	0.06
198	0.08
199	0.08
200	0.08
201	0.09
202	0.09
203	0.09
204	0.09
205	0.1
206	0.1
207	0.1
208	0.09
209	0.09
210	0.1
211	0.09
212	0.1
213	0.07
214	0.05
215	0.07
216	0.07
217	0.08
218	0.08
219	0.1
220	0.14
221	0.14
222	0.14
223	0.13
224	0.13
225	0.13
226	0.12
227	0.1
228	0.07
229	0.07
230	0.06
231	0.07
232	0.06
233	0.06
234	0.06
235	0.06
236	0.06
237	0.06
238	0.06
239	0.07
240	0.07
241	0.07
242	0.07
243	0.07
244	0.07
245	0.07
246	0.09
247	0.1
248	0.12
249	0.15
250	0.21
251	0.26
252	0.26
253	0.3
254	0.3
255	0.29
256	0.29
257	0.29
258	0.26
259	0.23
260	0.23
261	0.22
262	0.23
263	0.27
264	0.28
265	0.26
266	0.22
267	0.21
268	0.19
269	0.16
270	0.12
271	0.08
272	0.05
273	0.04
274	0.04
275	0.05
276	0.06
277	0.06
278	0.06
279	0.06
280	0.06
281	0.07
282	0.06
283	0.06
284	0.05
285	0.05
286	0.06
287	0.06
288	0.07
289	0.07
290	0.08
291	0.08
292	0.08
293	0.08
294	0.08
295	0.08
296	0.07
297	0.07
298	0.08
299	0.09
300	0.1
301	0.1
302	0.1
303	0.09
304	0.1
305	0.13
306	0.14
307	0.13
308	0.14
309	0.18
310	0.21
311	0.21
312	0.21
313	0.18
314	0.15
315	0.15
316	0.13
317	0.1
318	0.07
319	0.06
320	0.06
321	0.07
322	0.07
323	0.12
324	0.14
325	0.14
326	0.16
327	0.17
328	0.2
329	0.22
330	0.28
331	0.23
332	0.27
333	0.27
334	0.27
335	0.27
336	0.24
337	0.19
338	0.15
339	0.15
340	0.1
341	0.11
342	0.09
343	0.08
344	0.08
345	0.08
346	0.06
347	0.06
348	0.07
349	0.07
350	0.08
351	0.09
352	0.09
353	0.11
354	0.13
355	0.14
356	0.14
357	0.15
358	0.19
359	0.18
360	0.18
361	0.17
362	0.16
363	0.14
364	0.13
365	0.11
366	0.07
367	0.08
368	0.07
369	0.08
370	0.09
371	0.1
372	0.12
373	0.12
374	0.13
375	0.14
376	0.16
377	0.17
378	0.17
379	0.17
380	0.17
381	0.18
382	0.17
383	0.16
384	0.14
385	0.12
386	0.13
387	0.13
388	0.12
389	0.12
390	0.12
391	0.14
392	0.15
393	0.14
394	0.13
395	0.14
396	0.16
397	0.16
398	0.18
399	0.17
400	0.17
401	0.16
402	0.22
403	0.24
404	0.27
405	0.3
406	0.33
407	0.4
408	0.41
409	0.45
410	0.44
411	0.46
412	0.46
413	0.46
414	0.43
415	0.36
416	0.36
417	0.36
418	0.31
419	0.25
420	0.2
421	0.15
422	0.14
423	0.14
424	0.15
425	0.13
426	0.12
427	0.12
428	0.18
429	0.19
430	0.25
431	0.31
432	0.36
433	0.4
434	0.4
435	0.45
436	0.41
437	0.41
438	0.39
439	0.34
440	0.29
441	0.25
442	0.26
443	0.21
444	0.19
445	0.17
446	0.13
447	0.13
448	0.12
449	0.13
450	0.12
451	0.12
452	0.13
453	0.15
454	0.19
455	0.18
456	0.18
457	0.19
458	0.19
459	0.25
460	0.23
461	0.22
462	0.18
463	0.19
464	0.17
465	0.14
466	0.15
467	0.09
468	0.09
469	0.09
470	0.08
471	0.08
472	0.08
473	0.07
474	0.08
475	0.08
476	0.1
477	0.14
478	0.17
479	0.21
480	0.31
481	0.4
482	0.49
483	0.5
484	0.57
485	0.63
486	0.66

A0A179V271

3D AlphaFold-predicted Structure Viewer