Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5N7AI37

Protein Details
Accession A0A5N7AI37    Localization Confidence Medium Confidence Score 13.5
NoLS Segment(s)
PositionSequenceProtein Nature
29-51ECQARACNRCRQRKIRCDRSTPCHydrophilic
56-81RAKTRCMYSGRYKPREKRQRVLISAQHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 25.5, cyto_nucl 14
Family & Domain DBs
InterPro View protein in InterPro  
IPR036864  Zn2-C6_fun-type_DNA-bd_sf  
IPR001138  Zn2Cys6_DnaBD  
Gene Ontology GO:0005634  C:nucleus  
GO:0003677  F:DNA binding  
GO:0000981  F:DNA-binding transcription factor activity, RNA polymerase II-specific  
GO:0008270  F:zinc ion binding  
Pfam View protein in Pfam  
PF00172  Zn_clus  
PROSITE View protein in PROSITE  
PS00463  ZN2_CY6_FUNGAL_1  
PS50048  ZN2_CY6_FUNGAL_2  
CDD cd00067  GAL4  
Amino Acid Sequences MEGDTDDSVTDDTSTLDKPQKEGHERPLECQARACNRCRQRKIRCDRSTPCSQCIRAKTRCMYSGRYKPREKRQRVLISAQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.1
2 0.13
3 0.19
4 0.19
5 0.21
6 0.26
7 0.34
8 0.4
9 0.43
10 0.49
11 0.53
12 0.53
13 0.54
14 0.58
15 0.53
16 0.45
17 0.44
18 0.39
19 0.39
20 0.42
21 0.44
22 0.42
23 0.49
24 0.59
25 0.64
26 0.69
27 0.69
28 0.75
29 0.82
30 0.84
31 0.81
32 0.8
33 0.77
34 0.74
35 0.75
36 0.68
37 0.63
38 0.58
39 0.55
40 0.52
41 0.54
42 0.55
43 0.5
44 0.54
45 0.55
46 0.54
47 0.57
48 0.54
49 0.53
50 0.55
51 0.6
52 0.64
53 0.67
54 0.72
55 0.75
56 0.83
57 0.87
58 0.85
59 0.84
60 0.84
61 0.86