Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A179UW73

Protein Details
Accession A0A179UW73    Localization Confidence Medium Confidence Score 11.1
NoLS Segment(s)
PositionSequenceProtein Nature
24-53ILLRSLFIEKKRKKYKKRKTFKSPEIKDLFHydrophilic
NLS Segment(s)
PositionSequence
20-45KLRRILLRSLFIEKKRKKYKKRKTFK
Subcellular Location(s) mito 18, nucl 8
Family & Domain DBs
Amino Acid Sequences QQNLLSLNLLSQNLLKILRKLRRILLRSLFIEKKRKKYKKRKTFKSPEIKDLFSKFQIREILQKNKVNFNLIFRIRNEINQQFFSQLISDIK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.16
2 0.17
3 0.19
4 0.28
5 0.34
6 0.39
7 0.41
8 0.47
9 0.54
10 0.55
11 0.58
12 0.56
13 0.54
14 0.51
15 0.55
16 0.52
17 0.49
18 0.56
19 0.54
20 0.58
21 0.64
22 0.71
23 0.76
24 0.81
25 0.87
26 0.87
27 0.93
28 0.93
29 0.93
30 0.94
31 0.93
32 0.92
33 0.85
34 0.83
35 0.75
36 0.66
37 0.58
38 0.51
39 0.43
40 0.36
41 0.36
42 0.27
43 0.27
44 0.29
45 0.28
46 0.33
47 0.37
48 0.43
49 0.47
50 0.51
51 0.49
52 0.52
53 0.53
54 0.49
55 0.43
56 0.39
57 0.4
58 0.39
59 0.4
60 0.34
61 0.4
62 0.36
63 0.4
64 0.42
65 0.4
66 0.42
67 0.41
68 0.41
69 0.35
70 0.34
71 0.31
72 0.24