FuNGI

A0A179UTB8

Protein Details

Accession

A0A179UTB8

Localization Confidence

Low

Confidence Score

NoLS Segment(s)

Position	Sequence	Protein Nature
58-80	GSLKRSADQTHRKLKPRHIQLIG	Hydrophilic

NLS Segment(s)

Subcellular Location(s)

plas 26

Family & Domain DBs

InterPro	View protein in InterPro IPR004841 AA-permease/SLC12A_dom IPR004840 Amoino_acid_permease_CS
Gene Ontology	GO:0016020 C:membrane GO:0006865 P:amino acid transport GO:0055085 P:transmembrane transport
Pfam	View protein in Pfam PF00324 AA_permease
PROSITE	View protein in PROSITE PS00218 AMINO_ACID_PERMEASE_1

Amino Acid Sequences

MGLPESAPISIENIAHPTARSSDVEKFPSGELRKRPYTDFLEPVFTGSNDASSTDEAGSLKRSADQTHRKLKPRHIQLIGIGGTIGTALYVQIGKGLMNGGPASLFLAFTLWSSFILAVTISMAEMVTYLPISSPFIRFASRYVDEAFGVATGYNFFVFEAAMVPFEIVACNVIIHYWSDVVPVAGIITIVLVAYGVINFFAVQWYGESEFWLALGKALLIIGLIIFTFITMLGGNPLGDRYGFRYWREPGAFAELYKTGDLGRFLGFLQCLILASFTIAGPDYVSMAAGETENPRYVLPRAFNAVFYRLTAFFVLGSLCVGIVVPYNDPTMSDAFGNGLPGAAASPYVVAMDRLQIKVLPHIVNAMVLGAAFSAGNSYVYCASRSLFGLALEGKAPRIFTKCNKHGVPGLLRPACPAHCTAVLPPGFQRSCRRVGLPLRSPGFMKALDAQVSLATRSHTRGSSSHILHITLARGR

FASTA Sequence
with NoLS information

AlphaFold Structure
with highlighted NoLS

NoLS Predictions per Residue

Residue Number	Score
1	0.17
2	0.17
3	0.17
4	0.17
5	0.18
6	0.2
7	0.21
8	0.23
9	0.3
10	0.35
11	0.39
12	0.38
13	0.37
14	0.35
15	0.42
16	0.43
17	0.43
18	0.45
19	0.49
20	0.56
21	0.57
22	0.59
23	0.58
24	0.6
25	0.59
26	0.57
27	0.51
28	0.49
29	0.45
30	0.43
31	0.38
32	0.3
33	0.25
34	0.19
35	0.18
36	0.13
37	0.13
38	0.13
39	0.12
40	0.14
41	0.12
42	0.13
43	0.12
44	0.13
45	0.15
46	0.15
47	0.14
48	0.17
49	0.19
50	0.21
51	0.31
52	0.41
53	0.47
54	0.56
55	0.64
56	0.7
57	0.75
58	0.81
59	0.81
60	0.81
61	0.81
62	0.75
63	0.69
64	0.62
65	0.62
66	0.52
67	0.42
68	0.31
69	0.21
70	0.17
71	0.14
72	0.11
73	0.03
74	0.03
75	0.02
76	0.04
77	0.04
78	0.04
79	0.06
80	0.06
81	0.06
82	0.07
83	0.08
84	0.07
85	0.09
86	0.09
87	0.07
88	0.07
89	0.07
90	0.08
91	0.07
92	0.06
93	0.05
94	0.05
95	0.05
96	0.06
97	0.07
98	0.06
99	0.06
100	0.07
101	0.07
102	0.07
103	0.07
104	0.06
105	0.05
106	0.05
107	0.05
108	0.04
109	0.04
110	0.04
111	0.03
112	0.04
113	0.04
114	0.04
115	0.04
116	0.04
117	0.04
118	0.05
119	0.08
120	0.09
121	0.11
122	0.13
123	0.14
124	0.16
125	0.16
126	0.17
127	0.21
128	0.21
129	0.22
130	0.21
131	0.21
132	0.2
133	0.19
134	0.18
135	0.1
136	0.09
137	0.07
138	0.05
139	0.05
140	0.05
141	0.05
142	0.05
143	0.05
144	0.05
145	0.05
146	0.05
147	0.05
148	0.05
149	0.05
150	0.05
151	0.05
152	0.05
153	0.05
154	0.05
155	0.04
156	0.04
157	0.04
158	0.04
159	0.04
160	0.04
161	0.04
162	0.05
163	0.05
164	0.05
165	0.05
166	0.06
167	0.06
168	0.06
169	0.06
170	0.05
171	0.05
172	0.04
173	0.04
174	0.03
175	0.02
176	0.02
177	0.02
178	0.02
179	0.02
180	0.02
181	0.02
182	0.02
183	0.02
184	0.02
185	0.02
186	0.03
187	0.03
188	0.03
189	0.03
190	0.04
191	0.04
192	0.05
193	0.07
194	0.07
195	0.07
196	0.07
197	0.07
198	0.07
199	0.08
200	0.06
201	0.05
202	0.05
203	0.04
204	0.04
205	0.04
206	0.04
207	0.03
208	0.03
209	0.02
210	0.02
211	0.02
212	0.02
213	0.02
214	0.02
215	0.02
216	0.02
217	0.03
218	0.03
219	0.03
220	0.03
221	0.04
222	0.04
223	0.04
224	0.04
225	0.04
226	0.04
227	0.04
228	0.08
229	0.14
230	0.16
231	0.17
232	0.21
233	0.23
234	0.29
235	0.29
236	0.26
237	0.22
238	0.26
239	0.25
240	0.21
241	0.21
242	0.16
243	0.16
244	0.15
245	0.14
246	0.08
247	0.08
248	0.09
249	0.08
250	0.08
251	0.07
252	0.08
253	0.09
254	0.08
255	0.07
256	0.07
257	0.06
258	0.06
259	0.05
260	0.05
261	0.04
262	0.04
263	0.04
264	0.04
265	0.04
266	0.04
267	0.04
268	0.04
269	0.04
270	0.05
271	0.04
272	0.04
273	0.04
274	0.04
275	0.04
276	0.04
277	0.05
278	0.07
279	0.08
280	0.09
281	0.09
282	0.09
283	0.11
284	0.13
285	0.15
286	0.15
287	0.16
288	0.2
289	0.2
290	0.22
291	0.22
292	0.23
293	0.2
294	0.19
295	0.19
296	0.15
297	0.15
298	0.14
299	0.12
300	0.09
301	0.09
302	0.09
303	0.06
304	0.06
305	0.04
306	0.04
307	0.04
308	0.04
309	0.03
310	0.05
311	0.05
312	0.06
313	0.07
314	0.08
315	0.08
316	0.08
317	0.1
318	0.1
319	0.1
320	0.09
321	0.08
322	0.09
323	0.09
324	0.1
325	0.08
326	0.07
327	0.05
328	0.05
329	0.05
330	0.04
331	0.04
332	0.03
333	0.03
334	0.04
335	0.04
336	0.04
337	0.05
338	0.05
339	0.1
340	0.13
341	0.13
342	0.14
343	0.15
344	0.16
345	0.19
346	0.24
347	0.21
348	0.18
349	0.19
350	0.19
351	0.17
352	0.16
353	0.12
354	0.07
355	0.06
356	0.05
357	0.04
358	0.04
359	0.03
360	0.03
361	0.04
362	0.04
363	0.05
364	0.05
365	0.07
366	0.1
367	0.11
368	0.12
369	0.12
370	0.12
371	0.14
372	0.15
373	0.15
374	0.13
375	0.13
376	0.14
377	0.14
378	0.15
379	0.14
380	0.13
381	0.13
382	0.13
383	0.14
384	0.14
385	0.18
386	0.23
387	0.31
388	0.41
389	0.46
390	0.55
391	0.55
392	0.56
393	0.58
394	0.59
395	0.57
396	0.53
397	0.56
398	0.5
399	0.49
400	0.47
401	0.45
402	0.39
403	0.34
404	0.29
405	0.24
406	0.23
407	0.25
408	0.24
409	0.28
410	0.28
411	0.27
412	0.27
413	0.32
414	0.31
415	0.34
416	0.41
417	0.39
418	0.44
419	0.47
420	0.48
421	0.47
422	0.55
423	0.61
424	0.6
425	0.63
426	0.6
427	0.57
428	0.56
429	0.5
430	0.45
431	0.34
432	0.29
433	0.25
434	0.26
435	0.26
436	0.25
437	0.23
438	0.22
439	0.22
440	0.21
441	0.17
442	0.15
443	0.16
444	0.19
445	0.24
446	0.23
447	0.26
448	0.26
449	0.33
450	0.4
451	0.41
452	0.44
453	0.42
454	0.41
455	0.39
456	0.4

A0A179UTB8

3D AlphaFold-predicted Structure Viewer