Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

Q752Q9

Protein Details
Accession Q752Q9    Localization Confidence High Confidence Score 16.1
NoLS Segment(s)
PositionSequenceProtein Nature
179-200QVTKTSGKRAHYKRVRDRRRRPBasic
NLS Segment(s)
PositionSequence
185-200GKRAHYKRVRDRRRRP
Subcellular Location(s) nucl 21, mito 3, cyto 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR039883  Fcf2/DNTTIP2  
IPR014810  Fcf2_C  
Gene Ontology GO:0005730  C:nucleolus  
GO:0000480  P:endonucleolytic cleavage in 5'-ETS of tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)  
GO:0000447  P:endonucleolytic cleavage in ITS1 to separate SSU-rRNA from 5.8S rRNA and LSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)  
GO:0000472  P:endonucleolytic cleavage to generate mature 5'-end of SSU-rRNA from (SSU-rRNA, 5.8S rRNA, LSU-rRNA)  
GO:0006396  P:RNA processing  
KEGG ago:AGOS_AFR514C  -  
Pfam View protein in Pfam  
PF08698  Fcf2  
Amino Acid Sequences MSDQDIDALFASLRSAAPPTATPAPDAPTDDVLSVADADADARHAAFRDIEQRLRRLPRIQSGFDGLAAQPPARARSAPPAPAPPAADWFQLPRPELTPELRRDLALIKHRAALDPKRHYRKEKWQVPERFSVGTVIEGTGEFYSSRLQNSQRKATMLETLLADDDSARYFRRRYAEVQVTKTSGKRAHYKRVRDRRRRP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.08
2 0.1
3 0.09
4 0.11
5 0.12
6 0.17
7 0.22
8 0.23
9 0.23
10 0.23
11 0.26
12 0.26
13 0.28
14 0.24
15 0.21
16 0.22
17 0.19
18 0.18
19 0.15
20 0.14
21 0.11
22 0.08
23 0.06
24 0.05
25 0.05
26 0.05
27 0.05
28 0.05
29 0.05
30 0.06
31 0.06
32 0.07
33 0.08
34 0.1
35 0.16
36 0.2
37 0.26
38 0.29
39 0.32
40 0.38
41 0.44
42 0.46
43 0.45
44 0.46
45 0.49
46 0.51
47 0.5
48 0.45
49 0.43
50 0.39
51 0.33
52 0.29
53 0.2
54 0.17
55 0.15
56 0.13
57 0.1
58 0.11
59 0.12
60 0.12
61 0.12
62 0.11
63 0.19
64 0.23
65 0.25
66 0.26
67 0.28
68 0.29
69 0.3
70 0.3
71 0.22
72 0.22
73 0.2
74 0.19
75 0.15
76 0.16
77 0.17
78 0.18
79 0.18
80 0.15
81 0.15
82 0.16
83 0.18
84 0.2
85 0.23
86 0.23
87 0.26
88 0.25
89 0.24
90 0.23
91 0.23
92 0.25
93 0.26
94 0.27
95 0.23
96 0.26
97 0.26
98 0.27
99 0.29
100 0.31
101 0.33
102 0.39
103 0.47
104 0.53
105 0.58
106 0.63
107 0.66
108 0.71
109 0.73
110 0.72
111 0.72
112 0.73
113 0.76
114 0.73
115 0.71
116 0.62
117 0.52
118 0.44
119 0.36
120 0.26
121 0.2
122 0.16
123 0.1
124 0.08
125 0.07
126 0.08
127 0.07
128 0.07
129 0.06
130 0.06
131 0.09
132 0.1
133 0.11
134 0.14
135 0.21
136 0.27
137 0.34
138 0.41
139 0.41
140 0.42
141 0.42
142 0.41
143 0.39
144 0.34
145 0.29
146 0.21
147 0.2
148 0.19
149 0.16
150 0.14
151 0.09
152 0.08
153 0.08
154 0.09
155 0.1
156 0.13
157 0.14
158 0.19
159 0.25
160 0.28
161 0.31
162 0.4
163 0.49
164 0.53
165 0.57
166 0.57
167 0.54
168 0.54
169 0.51
170 0.48
171 0.42
172 0.41
173 0.46
174 0.49
175 0.57
176 0.63
177 0.72
178 0.76
179 0.83
180 0.89