Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5N6ZWI2

Protein Details
Accession A0A5N6ZWI2    Localization Confidence Low Confidence Score 6.1
NoLS Segment(s)
PositionSequenceProtein Nature
80-111KRLCDGCKPVRRKNRVYIICSKNPKHKQRQGKHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 21.5, cyto_mito 11.5, nucl 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR000473  Ribosomal_L36  
IPR035977  Ribosomal_L36_sp  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00444  Ribosomal_L36  
PROSITE View protein in PROSITE  
PS00828  RIBOSOMAL_L36  
Amino Acid Sequences MVSFRSLIAPSTGLFRQFLRKPLAGGFLARSFSQLTTLSLTNGLRALRSGKEQAGNVSVAASTVRQLDQIRGMKTRSSVKRLCDGCKPVRRKNRVYIICSKNPKHKQRQGK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.17
2 0.18
3 0.24
4 0.27
5 0.33
6 0.34
7 0.34
8 0.34
9 0.35
10 0.38
11 0.3
12 0.28
13 0.25
14 0.21
15 0.21
16 0.2
17 0.19
18 0.15
19 0.14
20 0.16
21 0.13
22 0.12
23 0.14
24 0.14
25 0.13
26 0.15
27 0.14
28 0.12
29 0.13
30 0.12
31 0.09
32 0.1
33 0.12
34 0.1
35 0.13
36 0.14
37 0.14
38 0.17
39 0.17
40 0.17
41 0.17
42 0.16
43 0.13
44 0.11
45 0.09
46 0.07
47 0.06
48 0.05
49 0.04
50 0.05
51 0.05
52 0.08
53 0.08
54 0.1
55 0.17
56 0.21
57 0.23
58 0.24
59 0.25
60 0.24
61 0.27
62 0.36
63 0.34
64 0.38
65 0.4
66 0.41
67 0.48
68 0.51
69 0.51
70 0.5
71 0.52
72 0.54
73 0.6
74 0.65
75 0.66
76 0.73
77 0.78
78 0.77
79 0.79
80 0.8
81 0.79
82 0.78
83 0.78
84 0.76
85 0.77
86 0.79
87 0.75
88 0.75
89 0.77
90 0.81
91 0.82