Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A179UPP2

Protein Details
Accession A0A179UPP2    Localization Confidence Medium Confidence Score 11
NoLS Segment(s)
PositionSequenceProtein Nature
82-112QLQRQLRAVKERDRERKRRSEKGKGKTKSEGBasic
NLS Segment(s)
PositionSequence
90-109VKERDRERKRRSEKGKGKTK
Subcellular Location(s) cyto 13cyto_nucl 13, nucl 11
Family & Domain DBs
InterPro View protein in InterPro  
IPR018108  Mitochondrial_sb/sol_carrier  
IPR023395  Mt_carrier_dom_sf  
Gene Ontology GO:0005743  C:mitochondrial inner membrane  
KEGG bgh:BDBG_05659  -  
Pfam View protein in Pfam  
PF00153  Mito_carr  
PROSITE View protein in PROSITE  
PS50920  SOLCAR  
Amino Acid Sequences MPNDQDIPYEASIEHFELYHIYNDTSSDDTACRYRPDSEDWKAAVLKGPALPALGQGIAGAAGAAVSTISTYPLSLIVTRLQLQRQLRAVKERDRERKRRSEKGKGKTKSEGVDIDDDGDGDGDEEEYKGIIDAAKKIYENEGGLRELYAGLTQATGKAVMDSFVFFLTYSFLRQRRLRARGLKMHGSFLPVVDELAVGYLAESFTKLLTMPVSTVLTRKQVEGLVSASSSTEPGKKTAKTHTSSTSDIVSAIITEKGLRGLWAGYCASLILSLNPSLTFLLNQFFKLSLLPRDKRRRPPASATFLFAAISKAIASSLTYPFSMAKTRAQAATATATSAPTTRPPPTILHAIYSIARTEGFAALYAGLSGDVLRGFFSHGIAMLAKDTVYRLVVRAYYLLLRIVRRYPSPEELLARARARAEEVAVEMREGAGELAAKAGEKAGDVKGAVVKGMAGMSGIGSGRAAGIIGKVADGTAEVKSRVVEDVYEDSNATAEMVGEYVEDEAEEWRSLYRWFWDKGKL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.18
2 0.13
3 0.13
4 0.14
5 0.16
6 0.17
7 0.16
8 0.16
9 0.15
10 0.16
11 0.19
12 0.19
13 0.18
14 0.16
15 0.15
16 0.18
17 0.21
18 0.23
19 0.24
20 0.25
21 0.28
22 0.3
23 0.38
24 0.43
25 0.45
26 0.5
27 0.47
28 0.49
29 0.45
30 0.43
31 0.39
32 0.32
33 0.29
34 0.23
35 0.23
36 0.2
37 0.19
38 0.18
39 0.14
40 0.15
41 0.12
42 0.1
43 0.08
44 0.08
45 0.07
46 0.06
47 0.05
48 0.03
49 0.03
50 0.02
51 0.02
52 0.02
53 0.02
54 0.03
55 0.03
56 0.05
57 0.05
58 0.05
59 0.06
60 0.07
61 0.09
62 0.09
63 0.11
64 0.12
65 0.15
66 0.19
67 0.23
68 0.24
69 0.29
70 0.31
71 0.36
72 0.4
73 0.43
74 0.43
75 0.49
76 0.53
77 0.55
78 0.62
79 0.66
80 0.7
81 0.74
82 0.81
83 0.81
84 0.86
85 0.86
86 0.88
87 0.87
88 0.87
89 0.87
90 0.87
91 0.88
92 0.83
93 0.81
94 0.78
95 0.73
96 0.65
97 0.6
98 0.52
99 0.45
100 0.42
101 0.36
102 0.3
103 0.24
104 0.21
105 0.16
106 0.13
107 0.09
108 0.06
109 0.06
110 0.04
111 0.05
112 0.05
113 0.05
114 0.05
115 0.05
116 0.04
117 0.05
118 0.06
119 0.08
120 0.11
121 0.14
122 0.16
123 0.16
124 0.17
125 0.19
126 0.2
127 0.19
128 0.19
129 0.18
130 0.17
131 0.17
132 0.16
133 0.14
134 0.12
135 0.11
136 0.08
137 0.06
138 0.05
139 0.06
140 0.06
141 0.06
142 0.06
143 0.06
144 0.06
145 0.06
146 0.06
147 0.06
148 0.07
149 0.07
150 0.07
151 0.07
152 0.07
153 0.06
154 0.06
155 0.08
156 0.08
157 0.1
158 0.15
159 0.17
160 0.24
161 0.27
162 0.36
163 0.43
164 0.49
165 0.55
166 0.58
167 0.64
168 0.66
169 0.69
170 0.69
171 0.6
172 0.57
173 0.49
174 0.43
175 0.35
176 0.26
177 0.22
178 0.14
179 0.12
180 0.09
181 0.09
182 0.06
183 0.06
184 0.05
185 0.03
186 0.03
187 0.03
188 0.03
189 0.03
190 0.04
191 0.04
192 0.04
193 0.04
194 0.04
195 0.05
196 0.05
197 0.06
198 0.06
199 0.07
200 0.09
201 0.09
202 0.1
203 0.11
204 0.15
205 0.16
206 0.16
207 0.15
208 0.16
209 0.16
210 0.16
211 0.15
212 0.11
213 0.1
214 0.1
215 0.09
216 0.07
217 0.07
218 0.07
219 0.09
220 0.09
221 0.13
222 0.17
223 0.18
224 0.21
225 0.29
226 0.36
227 0.36
228 0.39
229 0.42
230 0.42
231 0.42
232 0.4
233 0.32
234 0.24
235 0.21
236 0.18
237 0.12
238 0.08
239 0.07
240 0.06
241 0.05
242 0.05
243 0.05
244 0.05
245 0.05
246 0.05
247 0.05
248 0.05
249 0.05
250 0.07
251 0.07
252 0.06
253 0.06
254 0.06
255 0.06
256 0.05
257 0.05
258 0.04
259 0.05
260 0.05
261 0.05
262 0.05
263 0.06
264 0.06
265 0.06
266 0.06
267 0.06
268 0.09
269 0.09
270 0.09
271 0.09
272 0.09
273 0.09
274 0.1
275 0.11
276 0.15
277 0.23
278 0.27
279 0.37
280 0.47
281 0.55
282 0.64
283 0.72
284 0.73
285 0.71
286 0.76
287 0.75
288 0.73
289 0.66
290 0.59
291 0.49
292 0.42
293 0.36
294 0.27
295 0.18
296 0.09
297 0.08
298 0.06
299 0.05
300 0.05
301 0.05
302 0.05
303 0.07
304 0.08
305 0.09
306 0.09
307 0.1
308 0.11
309 0.12
310 0.15
311 0.14
312 0.16
313 0.18
314 0.19
315 0.19
316 0.2
317 0.19
318 0.17
319 0.19
320 0.15
321 0.13
322 0.11
323 0.11
324 0.11
325 0.11
326 0.1
327 0.1
328 0.14
329 0.15
330 0.17
331 0.19
332 0.21
333 0.24
334 0.31
335 0.28
336 0.26
337 0.24
338 0.24
339 0.22
340 0.21
341 0.17
342 0.11
343 0.1
344 0.08
345 0.09
346 0.09
347 0.08
348 0.07
349 0.07
350 0.07
351 0.07
352 0.07
353 0.05
354 0.04
355 0.04
356 0.04
357 0.04
358 0.04
359 0.04
360 0.04
361 0.04
362 0.06
363 0.07
364 0.07
365 0.07
366 0.07
367 0.08
368 0.08
369 0.08
370 0.07
371 0.07
372 0.06
373 0.06
374 0.07
375 0.07
376 0.08
377 0.08
378 0.08
379 0.1
380 0.11
381 0.12
382 0.12
383 0.12
384 0.12
385 0.13
386 0.15
387 0.16
388 0.17
389 0.19
390 0.23
391 0.24
392 0.26
393 0.3
394 0.32
395 0.35
396 0.37
397 0.38
398 0.37
399 0.37
400 0.39
401 0.4
402 0.35
403 0.31
404 0.28
405 0.25
406 0.25
407 0.22
408 0.19
409 0.14
410 0.16
411 0.18
412 0.17
413 0.16
414 0.14
415 0.12
416 0.11
417 0.1
418 0.08
419 0.05
420 0.05
421 0.05
422 0.06
423 0.06
424 0.06
425 0.06
426 0.07
427 0.06
428 0.06
429 0.09
430 0.09
431 0.11
432 0.11
433 0.13
434 0.15
435 0.15
436 0.15
437 0.12
438 0.11
439 0.1
440 0.1
441 0.08
442 0.05
443 0.05
444 0.05
445 0.06
446 0.06
447 0.06
448 0.06
449 0.06
450 0.06
451 0.06
452 0.06
453 0.04
454 0.05
455 0.06
456 0.07
457 0.07
458 0.07
459 0.06
460 0.06
461 0.07
462 0.08
463 0.09
464 0.11
465 0.12
466 0.13
467 0.13
468 0.15
469 0.16
470 0.15
471 0.13
472 0.14
473 0.18
474 0.19
475 0.2
476 0.19
477 0.17
478 0.17
479 0.16
480 0.12
481 0.08
482 0.06
483 0.06
484 0.06
485 0.06
486 0.05
487 0.06
488 0.06
489 0.05
490 0.05
491 0.05
492 0.07
493 0.09
494 0.09
495 0.09
496 0.1
497 0.12
498 0.13
499 0.15
500 0.21
501 0.26
502 0.3