Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5N7A9C1

Protein Details
Accession A0A5N7A9C1   
Localization Confidence Medium
Confidence Score 12.2
NoLS Segment(s)
PositionSequenceProtein Nature
191-222SLGQNKRPNKVQAKTRQRERREKGNRYEYPEDHydrophilic
NLS Segment(s)
PositionSequence
203-212AKTRQRERRE
Subcellular Location(s) nucl 16.5, cyto_nucl 12.5, cyto 5.5, mito 5
Family & Domain DBs
Amino Acid Sequences MVSPSACARSVRISLFSYGHANGPIVQPHSEAQYHKTLAYNIRHLPNPPRHLRAKATGLSRRLQKEFLQNNNAEEFLVKVQREISDVAKEGCDQLLYSTGRDGNKQGPEEADTRSDLNAHSSEEAAAEGADIDIVVTICCEEGRHRSVAFVEELARRLAMLKHGDDSSQHWQLSINVTHRDIGNLEDCEQSLGQNKRPNKVQAKTRQRERREKGNRYEYPED
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.3
2 0.3
3 0.3
4 0.28
5 0.25
6 0.24
7 0.21
8 0.2
9 0.18
10 0.2
11 0.21
12 0.19
13 0.19
14 0.19
15 0.19
16 0.22
17 0.23
18 0.22
19 0.23
20 0.27
21 0.28
22 0.27
23 0.28
24 0.28
25 0.33
26 0.36
27 0.39
28 0.37
29 0.4
30 0.41
31 0.43
32 0.49
33 0.51
34 0.54
35 0.54
36 0.55
37 0.55
38 0.58
39 0.6
40 0.57
41 0.54
42 0.5
43 0.52
44 0.52
45 0.51
46 0.51
47 0.53
48 0.51
49 0.47
50 0.45
51 0.4
52 0.45
53 0.49
54 0.51
55 0.51
56 0.47
57 0.47
58 0.44
59 0.41
60 0.3
61 0.22
62 0.16
63 0.11
64 0.14
65 0.12
66 0.11
67 0.12
68 0.13
69 0.14
70 0.15
71 0.15
72 0.13
73 0.14
74 0.14
75 0.14
76 0.13
77 0.12
78 0.11
79 0.09
80 0.06
81 0.06
82 0.11
83 0.11
84 0.11
85 0.11
86 0.14
87 0.15
88 0.16
89 0.17
90 0.17
91 0.2
92 0.2
93 0.2
94 0.17
95 0.19
96 0.2
97 0.19
98 0.15
99 0.13
100 0.13
101 0.12
102 0.12
103 0.09
104 0.1
105 0.1
106 0.09
107 0.09
108 0.08
109 0.08
110 0.08
111 0.08
112 0.05
113 0.05
114 0.04
115 0.03
116 0.03
117 0.03
118 0.02
119 0.02
120 0.02
121 0.03
122 0.03
123 0.02
124 0.03
125 0.03
126 0.03
127 0.04
128 0.05
129 0.1
130 0.14
131 0.16
132 0.16
133 0.17
134 0.18
135 0.19
136 0.18
137 0.14
138 0.14
139 0.14
140 0.15
141 0.15
142 0.14
143 0.11
144 0.12
145 0.12
146 0.14
147 0.16
148 0.16
149 0.18
150 0.19
151 0.19
152 0.19
153 0.23
154 0.25
155 0.27
156 0.26
157 0.23
158 0.24
159 0.25
160 0.3
161 0.29
162 0.27
163 0.25
164 0.26
165 0.27
166 0.27
167 0.26
168 0.21
169 0.19
170 0.2
171 0.18
172 0.19
173 0.19
174 0.19
175 0.19
176 0.19
177 0.17
178 0.21
179 0.23
180 0.28
181 0.35
182 0.39
183 0.44
184 0.51
185 0.59
186 0.6
187 0.64
188 0.68
189 0.72
190 0.79
191 0.83
192 0.86
193 0.87
194 0.88
195 0.91
196 0.88
197 0.88
198 0.88
199 0.88
200 0.87
201 0.88
202 0.85