Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

Q750Z1

Protein Details
Accession Q750Z1   
Localization Confidence Low
Confidence Score 6.2
NoLS Segment(s)
PositionSequenceProtein Nature
7-33HHSCLCSGGRCRQRRCRRPSRMCLGGAHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 20, nucl 3, extr 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR020233  Slm4  
Gene Ontology GO:0000329  C:fungal-type vacuole membrane  
GO:0031902  C:late endosome membrane  
GO:0071986  C:Ragulator complex  
GO:0042802  F:identical protein binding  
GO:0032456  P:endocytic recycling  
GO:0016237  P:lysosomal microautophagy  
GO:0007165  P:signal transduction  
KEGG ago:AGOS_AGL204C  -  
Pfam View protein in Pfam  
PF16818  SLM4  
Amino Acid Sequences MQEALGHHSCLCSGGRCRQRRCRRPSRMCLGGAGQRCAGCPGFQALKMYVAPLCCGRRIHTRTVCTMAMLQSRSIKRLLQQTLEPTATPLSTYQLQSTVLLSSKTGSIVSFVSANPAHPTSGDALNNLKMMALLIKEKWSEDEHDPQAQATKSCYHVTVPARDDAAAAAAPLTTRIYTCELEDLHTCVAQIPGSDLLLLFIADSLFPHGMLVLKMKSLLSAFSEVYGYKLD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.31
2 0.4
3 0.5
4 0.59
5 0.68
6 0.78
7 0.82
8 0.87
9 0.89
10 0.9
11 0.92
12 0.93
13 0.91
14 0.87
15 0.78
16 0.71
17 0.64
18 0.6
19 0.53
20 0.45
21 0.37
22 0.3
23 0.29
24 0.28
25 0.24
26 0.18
27 0.15
28 0.18
29 0.18
30 0.19
31 0.21
32 0.19
33 0.21
34 0.21
35 0.21
36 0.17
37 0.15
38 0.15
39 0.18
40 0.19
41 0.19
42 0.21
43 0.23
44 0.32
45 0.36
46 0.45
47 0.47
48 0.49
49 0.49
50 0.53
51 0.49
52 0.39
53 0.36
54 0.3
55 0.27
56 0.24
57 0.22
58 0.24
59 0.25
60 0.25
61 0.25
62 0.23
63 0.23
64 0.3
65 0.32
66 0.28
67 0.29
68 0.31
69 0.34
70 0.34
71 0.29
72 0.22
73 0.19
74 0.16
75 0.14
76 0.11
77 0.1
78 0.11
79 0.12
80 0.12
81 0.12
82 0.13
83 0.13
84 0.13
85 0.11
86 0.09
87 0.09
88 0.08
89 0.08
90 0.07
91 0.07
92 0.07
93 0.06
94 0.06
95 0.06
96 0.07
97 0.07
98 0.06
99 0.09
100 0.09
101 0.09
102 0.1
103 0.1
104 0.1
105 0.09
106 0.1
107 0.09
108 0.12
109 0.12
110 0.11
111 0.12
112 0.13
113 0.13
114 0.12
115 0.1
116 0.07
117 0.06
118 0.06
119 0.06
120 0.06
121 0.06
122 0.08
123 0.09
124 0.09
125 0.11
126 0.12
127 0.15
128 0.18
129 0.24
130 0.25
131 0.27
132 0.27
133 0.25
134 0.28
135 0.25
136 0.22
137 0.17
138 0.16
139 0.17
140 0.18
141 0.18
142 0.15
143 0.21
144 0.24
145 0.29
146 0.28
147 0.27
148 0.27
149 0.26
150 0.25
151 0.19
152 0.16
153 0.1
154 0.07
155 0.06
156 0.05
157 0.05
158 0.05
159 0.06
160 0.05
161 0.06
162 0.08
163 0.12
164 0.13
165 0.14
166 0.17
167 0.16
168 0.19
169 0.2
170 0.2
171 0.17
172 0.16
173 0.16
174 0.13
175 0.13
176 0.11
177 0.1
178 0.1
179 0.1
180 0.1
181 0.1
182 0.09
183 0.08
184 0.08
185 0.08
186 0.05
187 0.05
188 0.05
189 0.05
190 0.05
191 0.08
192 0.08
193 0.08
194 0.08
195 0.08
196 0.1
197 0.11
198 0.15
199 0.12
200 0.12
201 0.14
202 0.14
203 0.15
204 0.14
205 0.15
206 0.14
207 0.17
208 0.16
209 0.16
210 0.18
211 0.16