Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A5N7A561

Protein Details
Accession A0A5N7A561    Localization Confidence Low Confidence Score 8.8
NoLS Segment(s)
PositionSequenceProtein Nature
30-60VLEHSTKMRAKWRKKRVRRLKRKRRKMRARRBasic
NLS Segment(s)
PositionSequence
36-60KMRAKWRKKRVRRLKRKRRKMRARR
Subcellular Location(s) mito 22.5, cyto_mito 12.5, nucl 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR007836  Ribosomal_L41  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF05162  Ribosomal_L41  
Amino Acid Sequences MLSHPRRTQEARPAAALRLSFNHLLILAEVLEHSTKMRAKWRKKRVRRLKRKRRKMRARR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.47
2 0.44
3 0.37
4 0.28
5 0.21
6 0.22
7 0.18
8 0.17
9 0.15
10 0.13
11 0.12
12 0.11
13 0.09
14 0.05
15 0.04
16 0.04
17 0.04
18 0.04
19 0.04
20 0.04
21 0.07
22 0.09
23 0.11
24 0.21
25 0.3
26 0.41
27 0.52
28 0.63
29 0.71
30 0.81
31 0.9
32 0.92
33 0.94
34 0.95
35 0.96
36 0.96
37 0.96
38 0.97
39 0.97
40 0.97