Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5N6ZP20

Protein Details
Accession A0A5N6ZP20    Localization Confidence Medium Confidence Score 13.9
NoLS Segment(s)
PositionSequenceProtein Nature
99-128PSDLARDRLSRKRRHRCNISRKVVSRCRTSHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 24, mito 3
Family & Domain DBs
Amino Acid Sequences MSHELGSWDQQGRLAVFLTDSNWMNGAIVTGSSPIQTSRWVILGPGDEQLEYLRELGMLFRYWNYPKVWQSFCDSYGGMRDVADVLLQFDNWYTANRGPSDLARDRLSRKRRHRCNISRKVVSRCRTSGGGSGH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.17
2 0.13
3 0.12
4 0.12
5 0.12
6 0.13
7 0.13
8 0.13
9 0.13
10 0.13
11 0.12
12 0.11
13 0.1
14 0.07
15 0.06
16 0.06
17 0.06
18 0.06
19 0.06
20 0.06
21 0.07
22 0.07
23 0.09
24 0.11
25 0.11
26 0.12
27 0.11
28 0.11
29 0.12
30 0.13
31 0.12
32 0.12
33 0.11
34 0.1
35 0.1
36 0.1
37 0.09
38 0.08
39 0.07
40 0.06
41 0.05
42 0.06
43 0.06
44 0.07
45 0.06
46 0.06
47 0.06
48 0.1
49 0.11
50 0.14
51 0.15
52 0.18
53 0.22
54 0.27
55 0.27
56 0.26
57 0.3
58 0.29
59 0.28
60 0.25
61 0.21
62 0.16
63 0.18
64 0.17
65 0.12
66 0.1
67 0.09
68 0.08
69 0.08
70 0.08
71 0.05
72 0.06
73 0.06
74 0.06
75 0.06
76 0.06
77 0.07
78 0.07
79 0.08
80 0.09
81 0.12
82 0.15
83 0.16
84 0.17
85 0.17
86 0.19
87 0.25
88 0.27
89 0.28
90 0.28
91 0.31
92 0.36
93 0.45
94 0.52
95 0.55
96 0.62
97 0.7
98 0.77
99 0.84
100 0.89
101 0.91
102 0.93
103 0.94
104 0.93
105 0.92
106 0.88
107 0.87
108 0.85
109 0.81
110 0.77
111 0.69
112 0.64
113 0.57
114 0.53