Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A5N7AEG4

Protein Details
Accession A0A5N7AEG4    Localization Confidence Low Confidence Score 6
NoLS Segment(s)
PositionSequenceProtein Nature
2-21FYWPKTPPSRGQRRSPGCPFHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 18, nucl 3, cyto 3, extr 3, cyto_nucl 3
Family & Domain DBs
Amino Acid Sequences MFYWPKTPPSRGQRRSPGCPFAHQVKTHTTSANRTLLITLNPFTNTGSAAIFRAFAALYAFPTGPNSIALIH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.77
2 0.81
3 0.79
4 0.76
5 0.67
6 0.65
7 0.6
8 0.57
9 0.56
10 0.48
11 0.44
12 0.41
13 0.43
14 0.4
15 0.39
16 0.33
17 0.3
18 0.33
19 0.33
20 0.27
21 0.22
22 0.22
23 0.19
24 0.18
25 0.16
26 0.12
27 0.1
28 0.1
29 0.11
30 0.1
31 0.09
32 0.09
33 0.08
34 0.08
35 0.08
36 0.08
37 0.08
38 0.08
39 0.07
40 0.08
41 0.07
42 0.06
43 0.08
44 0.07
45 0.08
46 0.1
47 0.1
48 0.1
49 0.12
50 0.13
51 0.12
52 0.12