Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A179UBT7

Protein Details
Accession A0A179UBT7   
Localization Confidence Low
Confidence Score 9.5
NoLS Segment(s)
PositionSequenceProtein Nature
89-114KNALDNCRNPPKRRQRPSIPRSRFYPHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 15.5, cyto_nucl 10.5, cyto 4.5, mito 4
Family & Domain DBs
Amino Acid Sequences MKEESISIRTKTTVTWTWTWTSIPTMDIPTPPPAPTPAGTVTAHQHPSFIAVRSLRVASARTQPIHTYIHTYIGRQRTKSPYPGIHTSKNALDNCRNPPKRRQRPSIPRSRFYPDRDVHVLEYLKKAA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.3
2 0.32
3 0.33
4 0.35
5 0.36
6 0.35
7 0.29
8 0.26
9 0.21
10 0.19
11 0.17
12 0.18
13 0.17
14 0.18
15 0.19
16 0.21
17 0.21
18 0.2
19 0.2
20 0.18
21 0.2
22 0.19
23 0.2
24 0.18
25 0.2
26 0.2
27 0.21
28 0.22
29 0.24
30 0.26
31 0.22
32 0.2
33 0.16
34 0.2
35 0.2
36 0.18
37 0.17
38 0.14
39 0.15
40 0.16
41 0.17
42 0.13
43 0.12
44 0.12
45 0.11
46 0.18
47 0.2
48 0.2
49 0.21
50 0.21
51 0.23
52 0.23
53 0.21
54 0.2
55 0.17
56 0.22
57 0.22
58 0.22
59 0.25
60 0.31
61 0.34
62 0.3
63 0.35
64 0.36
65 0.39
66 0.44
67 0.44
68 0.41
69 0.45
70 0.52
71 0.52
72 0.49
73 0.48
74 0.45
75 0.43
76 0.44
77 0.4
78 0.37
79 0.38
80 0.38
81 0.45
82 0.53
83 0.57
84 0.54
85 0.63
86 0.7
87 0.74
88 0.79
89 0.8
90 0.81
91 0.85
92 0.91
93 0.92
94 0.88
95 0.83
96 0.78
97 0.77
98 0.73
99 0.68
100 0.68
101 0.59
102 0.58
103 0.58
104 0.55
105 0.49
106 0.48
107 0.45
108 0.37