Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A5N6ZTK2

Protein Details
Accession A0A5N6ZTK2    Localization Confidence Low Confidence Score 9.1
NoLS Segment(s)
PositionSequenceProtein Nature
1-31MATKKRPIQRRRADSAKSKCQQRNRRMTTLFHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 11, mito 10, cyto 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR002100  TF_MADSbox  
IPR036879  TF_MADSbox_sf  
Gene Ontology GO:0005634  C:nucleus  
GO:0003677  F:DNA binding  
GO:0046983  F:protein dimerization activity  
GO:0006351  P:DNA-templated transcription  
GO:0045944  P:positive regulation of transcription by RNA polymerase II  
PROSITE View protein in PROSITE  
PS50066  MADS_BOX_2  
Amino Acid Sequences MATKKRPIQRRRADSAKSKCQQRNRRMTTLFRKAFEYCLECEADVSIMLRVRHTGQIVYFNSDGDGWPLSQVQLTSCYPVPRQITWQELAAQYNLTLKEPGKV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.82
2 0.83
3 0.82
4 0.78
5 0.79
6 0.77
7 0.79
8 0.82
9 0.82
10 0.83
11 0.8
12 0.82
13 0.77
14 0.79
15 0.78
16 0.79
17 0.72
18 0.62
19 0.58
20 0.5
21 0.47
22 0.41
23 0.34
24 0.24
25 0.22
26 0.21
27 0.17
28 0.17
29 0.14
30 0.11
31 0.08
32 0.07
33 0.06
34 0.08
35 0.08
36 0.08
37 0.09
38 0.1
39 0.12
40 0.12
41 0.11
42 0.1
43 0.16
44 0.17
45 0.2
46 0.18
47 0.17
48 0.17
49 0.16
50 0.15
51 0.1
52 0.1
53 0.06
54 0.07
55 0.07
56 0.07
57 0.07
58 0.07
59 0.07
60 0.11
61 0.11
62 0.14
63 0.15
64 0.18
65 0.18
66 0.25
67 0.27
68 0.25
69 0.3
70 0.32
71 0.35
72 0.34
73 0.35
74 0.32
75 0.3
76 0.3
77 0.26
78 0.21
79 0.17
80 0.2
81 0.19
82 0.17
83 0.18