Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A5N6ZUK2

Protein Details
Accession A0A5N6ZUK2    Localization Confidence Medium Confidence Score 11
NoLS Segment(s)
PositionSequenceProtein Nature
5-26EESPAQRAARLRRERREAKIKEBasic
NLS Segment(s)
PositionSequence
13-27ARLRRERREAKIKEG
Subcellular Location(s) mito 9, nucl 8, cyto 4, pero 3, plas 1, E.R. 1, golg 1
Family & Domain DBs
InterPro View protein in InterPro  
IPR028143  Get2/sif1  
Gene Ontology GO:0016020  C:membrane  
Pfam View protein in Pfam  
PF08690  GET2  
Amino Acid Sequences MSSAEESPAQRAARLRRERREAKIKEGGAARLDKITSLSGRTPTSMREETSPSPQPPAQISSTPETEKPQSQPAPAPASAPAQPTSNPEPQSPENLQAQQELFRALLRQGGPSSSEQGPQEEDPTMQMLNTLMAGMNGQDQAPGGAPGGAAGGPSPADLISALGLPPFVADLLGAATHKPTDEEKKEVRTWKVLHVLFAVAIGIYLLMLIGTSVSTYGSQPPPPATAQNPFLYFTTGEVVLTGARLMSKGRTGTAAGIMLWLQLFQDIVRDGSLVVFLLGMGAWWSREWTAY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.54
2 0.61
3 0.65
4 0.75
5 0.8
6 0.84
7 0.86
8 0.8
9 0.78
10 0.77
11 0.68
12 0.64
13 0.6
14 0.53
15 0.47
16 0.45
17 0.37
18 0.3
19 0.29
20 0.23
21 0.21
22 0.21
23 0.18
24 0.19
25 0.21
26 0.23
27 0.24
28 0.26
29 0.25
30 0.24
31 0.3
32 0.3
33 0.28
34 0.27
35 0.32
36 0.33
37 0.39
38 0.43
39 0.37
40 0.39
41 0.38
42 0.38
43 0.35
44 0.36
45 0.31
46 0.28
47 0.31
48 0.29
49 0.32
50 0.31
51 0.3
52 0.3
53 0.31
54 0.32
55 0.31
56 0.35
57 0.34
58 0.35
59 0.38
60 0.39
61 0.41
62 0.36
63 0.35
64 0.28
65 0.28
66 0.27
67 0.25
68 0.21
69 0.17
70 0.18
71 0.22
72 0.26
73 0.29
74 0.29
75 0.27
76 0.32
77 0.32
78 0.38
79 0.34
80 0.32
81 0.3
82 0.3
83 0.3
84 0.27
85 0.26
86 0.22
87 0.2
88 0.17
89 0.13
90 0.11
91 0.12
92 0.1
93 0.13
94 0.11
95 0.12
96 0.12
97 0.12
98 0.14
99 0.14
100 0.18
101 0.15
102 0.17
103 0.16
104 0.17
105 0.18
106 0.17
107 0.17
108 0.13
109 0.13
110 0.1
111 0.11
112 0.1
113 0.07
114 0.07
115 0.06
116 0.05
117 0.05
118 0.05
119 0.03
120 0.03
121 0.04
122 0.04
123 0.04
124 0.04
125 0.04
126 0.04
127 0.04
128 0.05
129 0.05
130 0.05
131 0.04
132 0.04
133 0.04
134 0.04
135 0.04
136 0.03
137 0.03
138 0.03
139 0.03
140 0.03
141 0.03
142 0.03
143 0.03
144 0.03
145 0.03
146 0.03
147 0.04
148 0.04
149 0.04
150 0.04
151 0.04
152 0.03
153 0.03
154 0.03
155 0.03
156 0.02
157 0.02
158 0.02
159 0.03
160 0.03
161 0.04
162 0.04
163 0.04
164 0.04
165 0.05
166 0.06
167 0.09
168 0.17
169 0.2
170 0.26
171 0.3
172 0.35
173 0.41
174 0.45
175 0.45
176 0.43
177 0.42
178 0.42
179 0.47
180 0.41
181 0.37
182 0.32
183 0.3
184 0.23
185 0.21
186 0.15
187 0.06
188 0.05
189 0.04
190 0.03
191 0.02
192 0.02
193 0.02
194 0.02
195 0.02
196 0.02
197 0.02
198 0.02
199 0.02
200 0.02
201 0.03
202 0.04
203 0.05
204 0.11
205 0.14
206 0.15
207 0.17
208 0.19
209 0.21
210 0.22
211 0.25
212 0.23
213 0.26
214 0.28
215 0.3
216 0.3
217 0.29
218 0.28
219 0.27
220 0.23
221 0.19
222 0.17
223 0.14
224 0.12
225 0.11
226 0.11
227 0.08
228 0.08
229 0.07
230 0.05
231 0.05
232 0.05
233 0.07
234 0.08
235 0.12
236 0.13
237 0.14
238 0.16
239 0.17
240 0.18
241 0.2
242 0.18
243 0.14
244 0.14
245 0.13
246 0.11
247 0.1
248 0.08
249 0.06
250 0.05
251 0.06
252 0.05
253 0.08
254 0.09
255 0.1
256 0.1
257 0.1
258 0.1
259 0.1
260 0.11
261 0.07
262 0.06
263 0.05
264 0.05
265 0.05
266 0.04
267 0.04
268 0.05
269 0.05
270 0.06
271 0.06
272 0.09