Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5N7A7Q1

Protein Details
Accession A0A5N7A7Q1    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
62-81QWGSKESGKAKKKEREEKENBasic
NLS Segment(s)
PositionSequence
69-78GKAKKKEREE
Subcellular Location(s) extr 16, golg 4, E.R. 3, mito 1, cyto 1, pero 1, vacu 1, cyto_mito 1, cyto_pero 1
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MENLAYSATAAGQFLSTLICLSVLGLTSVASIMHGDDVRMQCIIAYISCFQPAPYPGTYGVQWGSKESGKAKKKEREEKEN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.05
2 0.06
3 0.05
4 0.05
5 0.05
6 0.05
7 0.04
8 0.05
9 0.05
10 0.05
11 0.05
12 0.05
13 0.05
14 0.04
15 0.05
16 0.04
17 0.04
18 0.04
19 0.04
20 0.05
21 0.05
22 0.05
23 0.09
24 0.1
25 0.1
26 0.1
27 0.1
28 0.08
29 0.09
30 0.09
31 0.05
32 0.06
33 0.07
34 0.07
35 0.08
36 0.08
37 0.08
38 0.11
39 0.12
40 0.14
41 0.14
42 0.15
43 0.16
44 0.18
45 0.18
46 0.17
47 0.17
48 0.17
49 0.16
50 0.17
51 0.19
52 0.19
53 0.22
54 0.26
55 0.34
56 0.39
57 0.47
58 0.55
59 0.61
60 0.71
61 0.78