Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5N6ZZS6

Protein Details
Accession A0A5N6ZZS6    Localization Confidence Medium Confidence Score 11.3
NoLS Segment(s)
PositionSequenceProtein Nature
19-42GGDRGRGRGRRGRRGGKQEEKEWQBasic
NLS Segment(s)
PositionSequence
7-37RGRGGFGSRGDRGGDRGRGRGRRGRRGGKQE
Subcellular Location(s) nucl 9mito 9mito_nucl 9
Family & Domain DBs
InterPro View protein in InterPro  
IPR000851  Ribosomal_S5  
IPR005324  Ribosomal_S5_C  
IPR020568  Ribosomal_S5_D2-typ_fold  
IPR014721  Ribosomal_S5_D2-typ_fold_subgr  
IPR005711  Ribosomal_S5_euk/arc  
IPR013810  Ribosomal_S5_N  
IPR018192  Ribosomal_S5_N_CS  
Gene Ontology GO:0015935  C:small ribosomal subunit  
GO:0003723  F:RNA binding  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00333  Ribosomal_S5  
PF03719  Ribosomal_S5_C  
PROSITE View protein in PROSITE  
PS00585  RIBOSOMAL_S5  
PS50881  S5_DSRBD  
Amino Acid Sequences MADAAPRGRGGFGSRGDRGGDRGRGRGRRGRRGGKQEEKEWQPVTKLGRLVKAGKITSMEQIYLHSLPIKEYQIVDFFLPKLKDEVMKIKPVQKQTRAGQRTRFKAVVIIGDSEGHIGLGIKTSKEVATAIRAAITIAKLAVLPVRRGYWGSNLGEPHSLPVKQSAKCGSVSVRLIPAPRGTGLVASPAVKRLLQLAGVQDAYTSSSGSTKTLENTLKATFLAVVNTYGFLTPNLWKETKLIRSPLEEFGDVLRQGKKY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.31
2 0.33
3 0.34
4 0.34
5 0.35
6 0.36
7 0.39
8 0.35
9 0.42
10 0.49
11 0.54
12 0.6
13 0.64
14 0.66
15 0.69
16 0.76
17 0.78
18 0.79
19 0.83
20 0.86
21 0.88
22 0.86
23 0.81
24 0.8
25 0.75
26 0.72
27 0.64
28 0.55
29 0.47
30 0.44
31 0.42
32 0.37
33 0.37
34 0.33
35 0.35
36 0.37
37 0.39
38 0.39
39 0.4
40 0.36
41 0.33
42 0.32
43 0.29
44 0.3
45 0.27
46 0.23
47 0.17
48 0.18
49 0.2
50 0.18
51 0.17
52 0.15
53 0.14
54 0.15
55 0.19
56 0.19
57 0.17
58 0.17
59 0.18
60 0.17
61 0.18
62 0.17
63 0.14
64 0.13
65 0.17
66 0.17
67 0.15
68 0.15
69 0.15
70 0.17
71 0.18
72 0.26
73 0.24
74 0.3
75 0.32
76 0.38
77 0.41
78 0.48
79 0.53
80 0.5
81 0.55
82 0.55
83 0.63
84 0.62
85 0.62
86 0.62
87 0.62
88 0.61
89 0.59
90 0.53
91 0.42
92 0.39
93 0.36
94 0.3
95 0.24
96 0.2
97 0.15
98 0.14
99 0.14
100 0.11
101 0.1
102 0.06
103 0.05
104 0.04
105 0.03
106 0.06
107 0.06
108 0.06
109 0.06
110 0.07
111 0.07
112 0.07
113 0.08
114 0.06
115 0.08
116 0.09
117 0.09
118 0.08
119 0.08
120 0.08
121 0.08
122 0.07
123 0.05
124 0.04
125 0.04
126 0.04
127 0.04
128 0.07
129 0.07
130 0.08
131 0.09
132 0.1
133 0.11
134 0.12
135 0.13
136 0.15
137 0.19
138 0.19
139 0.21
140 0.2
141 0.21
142 0.21
143 0.2
144 0.17
145 0.15
146 0.14
147 0.11
148 0.19
149 0.23
150 0.23
151 0.27
152 0.28
153 0.28
154 0.28
155 0.29
156 0.23
157 0.23
158 0.24
159 0.22
160 0.2
161 0.2
162 0.2
163 0.2
164 0.2
165 0.15
166 0.14
167 0.14
168 0.12
169 0.12
170 0.11
171 0.11
172 0.11
173 0.11
174 0.11
175 0.12
176 0.13
177 0.13
178 0.13
179 0.13
180 0.13
181 0.13
182 0.14
183 0.14
184 0.15
185 0.15
186 0.15
187 0.13
188 0.12
189 0.12
190 0.1
191 0.09
192 0.07
193 0.08
194 0.09
195 0.1
196 0.11
197 0.11
198 0.13
199 0.2
200 0.22
201 0.22
202 0.24
203 0.24
204 0.24
205 0.22
206 0.21
207 0.15
208 0.13
209 0.14
210 0.11
211 0.12
212 0.11
213 0.12
214 0.12
215 0.11
216 0.11
217 0.09
218 0.11
219 0.14
220 0.19
221 0.24
222 0.24
223 0.24
224 0.28
225 0.36
226 0.42
227 0.44
228 0.45
229 0.43
230 0.48
231 0.51
232 0.53
233 0.49
234 0.41
235 0.36
236 0.32
237 0.35
238 0.3
239 0.3