Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5N6ZLY6

Protein Details
Accession A0A5N6ZLY6   
Localization Confidence Low
Confidence Score 8.7
NoLS Segment(s)
PositionSequenceProtein Nature
1-34MTAKRTIRHRRPDSAKSRCQQRNRRKIQLFLKAYHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 13.5, cyto_nucl 9.5, mito 9, cyto 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR002100  TF_MADSbox  
IPR036879  TF_MADSbox_sf  
Gene Ontology GO:0005634  C:nucleus  
GO:0003677  F:DNA binding  
GO:0046983  F:protein dimerization activity  
GO:0006351  P:DNA-templated transcription  
GO:0045944  P:positive regulation of transcription by RNA polymerase II  
PROSITE View protein in PROSITE  
PS50066  MADS_BOX_2  
Amino Acid Sequences MTAKRTIRHRRPDSAKSRCQQRNRRKIQLFLKAYEYCQECDADISLTIRLRHSGEIVFFNSDGSWSPSKEQLATYYPRPKQVTWQEIAARYKS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.84
2 0.83
3 0.79
4 0.83
5 0.81
6 0.83
7 0.83
8 0.84
9 0.85
10 0.85
11 0.89
12 0.83
13 0.83
14 0.81
15 0.8
16 0.73
17 0.64
18 0.61
19 0.51
20 0.47
21 0.43
22 0.36
23 0.26
24 0.23
25 0.21
26 0.15
27 0.14
28 0.14
29 0.09
30 0.08
31 0.08
32 0.08
33 0.09
34 0.1
35 0.09
36 0.1
37 0.11
38 0.11
39 0.11
40 0.11
41 0.11
42 0.13
43 0.14
44 0.13
45 0.12
46 0.12
47 0.11
48 0.1
49 0.1
50 0.12
51 0.12
52 0.12
53 0.14
54 0.18
55 0.19
56 0.2
57 0.2
58 0.19
59 0.22
60 0.26
61 0.32
62 0.38
63 0.39
64 0.46
65 0.49
66 0.46
67 0.51
68 0.58
69 0.58
70 0.51
71 0.55
72 0.53
73 0.56