Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5N7A7P0

Protein Details
Accession A0A5N7A7P0   
Localization Confidence Medium
Confidence Score 14.5
NoLS Segment(s)
PositionSequenceProtein Nature
13-46VPIRVYRVNTHRRHHRPPRRRHGREQNSERNHTGBasic
NLS Segment(s)
PositionSequence
23-37HRRHHRPPRRRHGRE
Subcellular Location(s) nucl 25.5, cyto_nucl 14
Family & Domain DBs
Amino Acid Sequences MAAELNDRIRRPVPIRVYRVNTHRRHHRPPRRRHGREQNSERNHTGRHEQPPRPAHVNSELNHEDRGPYHRDVHNSRPARPPADNKENIRPVPPANPAHLQTSVAYDRHDLNMRVDSSITAPGSSALATDTKMESESGNPIEHSDNPTSDYLQTSG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.52
2 0.58
3 0.63
4 0.67
5 0.67
6 0.73
7 0.74
8 0.71
9 0.71
10 0.75
11 0.75
12 0.79
13 0.84
14 0.86
15 0.86
16 0.9
17 0.92
18 0.93
19 0.91
20 0.91
21 0.92
22 0.91
23 0.92
24 0.91
25 0.9
26 0.86
27 0.83
28 0.75
29 0.66
30 0.57
31 0.49
32 0.45
33 0.42
34 0.44
35 0.48
36 0.49
37 0.55
38 0.58
39 0.6
40 0.58
41 0.52
42 0.45
43 0.44
44 0.46
45 0.38
46 0.41
47 0.37
48 0.34
49 0.33
50 0.3
51 0.22
52 0.18
53 0.21
54 0.17
55 0.17
56 0.21
57 0.23
58 0.29
59 0.33
60 0.38
61 0.44
62 0.42
63 0.44
64 0.46
65 0.45
66 0.43
67 0.42
68 0.42
69 0.41
70 0.48
71 0.5
72 0.46
73 0.52
74 0.54
75 0.51
76 0.46
77 0.39
78 0.32
79 0.31
80 0.33
81 0.27
82 0.25
83 0.28
84 0.28
85 0.29
86 0.28
87 0.25
88 0.19
89 0.21
90 0.2
91 0.18
92 0.17
93 0.15
94 0.16
95 0.18
96 0.22
97 0.18
98 0.19
99 0.23
100 0.23
101 0.22
102 0.21
103 0.19
104 0.16
105 0.19
106 0.17
107 0.11
108 0.11
109 0.11
110 0.11
111 0.1
112 0.09
113 0.06
114 0.07
115 0.07
116 0.09
117 0.09
118 0.09
119 0.1
120 0.11
121 0.1
122 0.11
123 0.16
124 0.17
125 0.17
126 0.17
127 0.18
128 0.21
129 0.22
130 0.26
131 0.24
132 0.23
133 0.25
134 0.26
135 0.26
136 0.24