Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5N6ZLS3

Protein Details
Accession A0A5N6ZLS3   
Localization Confidence Medium
Confidence Score 10.8
NoLS Segment(s)
PositionSequenceProtein Nature
1-34MAIKKRTIRRRRSDSSKAKCQQRNRRKVHLFLKAHydrophilic
NLS Segment(s)
PositionSequence
4-18KKRTIRRRRSDSSKA
Subcellular Location(s) mito 14, nucl 9.5, cyto_nucl 7, cyto 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR036879  TF_MADSbox_sf  
Gene Ontology GO:0003677  F:DNA binding  
GO:0046983  F:protein dimerization activity  
Amino Acid Sequences MAIKKRTIRRRRSDSSKAKCQQRNRRKVHLFLKAFEYCRECDADICLMIRLKHNGQVVFFKSDSDWPFPEEQLATHYPKPKQVTWQELAAQYES
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.89
2 0.88
3 0.88
4 0.86
5 0.86
6 0.84
7 0.85
8 0.85
9 0.85
10 0.87
11 0.83
12 0.86
13 0.82
14 0.83
15 0.81
16 0.8
17 0.72
18 0.63
19 0.61
20 0.54
21 0.49
22 0.43
23 0.37
24 0.27
25 0.26
26 0.25
27 0.19
28 0.15
29 0.15
30 0.13
31 0.11
32 0.11
33 0.1
34 0.1
35 0.1
36 0.11
37 0.12
38 0.12
39 0.17
40 0.19
41 0.19
42 0.19
43 0.23
44 0.24
45 0.25
46 0.24
47 0.2
48 0.18
49 0.23
50 0.24
51 0.24
52 0.22
53 0.21
54 0.23
55 0.22
56 0.23
57 0.19
58 0.16
59 0.17
60 0.2
61 0.22
62 0.25
63 0.32
64 0.32
65 0.39
66 0.44
67 0.42
68 0.48
69 0.52
70 0.56
71 0.52
72 0.56
73 0.53
74 0.52