Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A179UBM6

Protein Details
Accession A0A179UBM6   
Localization Confidence High
Confidence Score 15.7
NoLS Segment(s)
PositionSequenceProtein Nature
45-74YKNVVIKQWGLRRRPKRKPSGTKDDRHYVAHydrophilic
111-139SHTAHKDSKSRTDRRRHRHRPRGTGSPDLBasic
NLS Segment(s)
PositionSequence
56-64RRRPKRKPS
119-134KSRTDRRRHRHRPRGT
Subcellular Location(s) nucl 13, cyto_nucl 10, mito 7, cyto 5
Family & Domain DBs
Amino Acid Sequences MVQWKLQRIKAASAFDGYWQLLKTLYVEHTGHGMDDEMAQDCLNYKNVVIKQWGLRRRPKRKPSGTKDDRHYVATGILLSFISGARLVSLFDTRIKTIDEKAGYGPSTGASHTAHKDSKSRTDRRRHRHRPRGTGSPDLYSKAGPRIGQHDNRPIAPVAPEKRKRAHSDDDEEYRDPKMARIMAPRSCRSAREGASCSKYGMPGEDIMFDAQDSDLDSHGGNDTDFDSGYVDEESDSSRSNSCEPIFSEPVQENDTDTKSSMGSVKSGSTSGISAGNDLSELDRFIDDVTDNEYDAGPEETGALVWQYIEFHIIQSPLAGRPNILLAKVTLLHTKGEDKKPRVKTFVISHNPEPLLDLLRHLLFMAIHDEIFAPEFKKLEDIY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.4
2 0.35
3 0.35
4 0.28
5 0.24
6 0.19
7 0.18
8 0.15
9 0.15
10 0.14
11 0.15
12 0.16
13 0.19
14 0.19
15 0.2
16 0.22
17 0.21
18 0.2
19 0.17
20 0.16
21 0.1
22 0.11
23 0.11
24 0.1
25 0.1
26 0.1
27 0.09
28 0.1
29 0.12
30 0.13
31 0.12
32 0.12
33 0.19
34 0.22
35 0.26
36 0.27
37 0.3
38 0.36
39 0.45
40 0.52
41 0.53
42 0.61
43 0.68
44 0.76
45 0.82
46 0.85
47 0.87
48 0.9
49 0.93
50 0.93
51 0.93
52 0.92
53 0.9
54 0.87
55 0.84
56 0.75
57 0.66
58 0.57
59 0.46
60 0.37
61 0.3
62 0.23
63 0.14
64 0.12
65 0.09
66 0.08
67 0.08
68 0.07
69 0.06
70 0.06
71 0.05
72 0.05
73 0.06
74 0.06
75 0.07
76 0.09
77 0.1
78 0.13
79 0.16
80 0.16
81 0.17
82 0.19
83 0.19
84 0.21
85 0.26
86 0.23
87 0.22
88 0.23
89 0.25
90 0.23
91 0.21
92 0.19
93 0.13
94 0.13
95 0.12
96 0.12
97 0.11
98 0.14
99 0.16
100 0.21
101 0.23
102 0.24
103 0.3
104 0.32
105 0.41
106 0.47
107 0.54
108 0.58
109 0.67
110 0.75
111 0.8
112 0.88
113 0.89
114 0.9
115 0.91
116 0.92
117 0.92
118 0.87
119 0.87
120 0.8
121 0.77
122 0.67
123 0.61
124 0.52
125 0.43
126 0.38
127 0.28
128 0.25
129 0.2
130 0.2
131 0.16
132 0.17
133 0.21
134 0.27
135 0.32
136 0.35
137 0.4
138 0.39
139 0.39
140 0.39
141 0.34
142 0.27
143 0.24
144 0.26
145 0.24
146 0.32
147 0.38
148 0.41
149 0.46
150 0.51
151 0.54
152 0.54
153 0.57
154 0.53
155 0.54
156 0.55
157 0.54
158 0.51
159 0.46
160 0.41
161 0.32
162 0.28
163 0.21
164 0.17
165 0.16
166 0.14
167 0.16
168 0.21
169 0.26
170 0.3
171 0.35
172 0.35
173 0.37
174 0.36
175 0.35
176 0.32
177 0.33
178 0.3
179 0.3
180 0.32
181 0.31
182 0.33
183 0.32
184 0.3
185 0.24
186 0.23
187 0.17
188 0.15
189 0.12
190 0.1
191 0.1
192 0.1
193 0.1
194 0.09
195 0.08
196 0.07
197 0.06
198 0.05
199 0.04
200 0.04
201 0.05
202 0.05
203 0.05
204 0.06
205 0.06
206 0.06
207 0.07
208 0.06
209 0.06
210 0.06
211 0.06
212 0.06
213 0.06
214 0.06
215 0.06
216 0.07
217 0.06
218 0.05
219 0.05
220 0.05
221 0.06
222 0.07
223 0.08
224 0.08
225 0.09
226 0.1
227 0.12
228 0.15
229 0.14
230 0.16
231 0.17
232 0.22
233 0.24
234 0.24
235 0.26
236 0.23
237 0.24
238 0.23
239 0.21
240 0.17
241 0.16
242 0.18
243 0.15
244 0.15
245 0.13
246 0.12
247 0.13
248 0.15
249 0.12
250 0.12
251 0.12
252 0.13
253 0.13
254 0.13
255 0.13
256 0.1
257 0.1
258 0.1
259 0.12
260 0.11
261 0.1
262 0.1
263 0.09
264 0.09
265 0.09
266 0.08
267 0.06
268 0.06
269 0.07
270 0.07
271 0.07
272 0.07
273 0.08
274 0.07
275 0.08
276 0.11
277 0.11
278 0.11
279 0.11
280 0.11
281 0.1
282 0.11
283 0.11
284 0.07
285 0.07
286 0.07
287 0.07
288 0.07
289 0.07
290 0.05
291 0.04
292 0.04
293 0.05
294 0.05
295 0.05
296 0.07
297 0.07
298 0.08
299 0.1
300 0.1
301 0.1
302 0.11
303 0.12
304 0.13
305 0.16
306 0.16
307 0.14
308 0.14
309 0.2
310 0.2
311 0.19
312 0.17
313 0.14
314 0.16
315 0.18
316 0.19
317 0.18
318 0.18
319 0.18
320 0.2
321 0.28
322 0.34
323 0.42
324 0.5
325 0.53
326 0.61
327 0.7
328 0.76
329 0.73
330 0.68
331 0.66
332 0.64
333 0.68
334 0.68
335 0.64
336 0.6
337 0.61
338 0.58
339 0.5
340 0.44
341 0.35
342 0.3
343 0.23
344 0.23
345 0.19
346 0.19
347 0.19
348 0.17
349 0.16
350 0.12
351 0.13
352 0.15
353 0.12
354 0.12
355 0.12
356 0.13
357 0.12
358 0.14
359 0.14
360 0.12
361 0.13
362 0.14
363 0.14