Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A179V1J5

Protein Details
Accession A0A179V1J5    Localization Confidence Low Confidence Score 5.4
NoLS Segment(s)
PositionSequenceProtein Nature
126-152WMYCTPPAPIWRRPRSRRRICLNNVLDHydrophilic
NLS Segment(s)
Subcellular Location(s) plas 16, mito 5, extr 2, nucl 1, cyto 1, cyto_nucl 1, E.R. 1, vacu 1
Family & Domain DBs
Amino Acid Sequences MYITVLVHSSSSFWPPPSSAVFDTASKNHETIKAAFPTHSLSAPPCTLRSFLERYPPHEPKAICNPKPLIRRTLPPIRWPIEFVALIIIIASLPYPTCTSVRGLYESYDINKPERCRSNQQPVHTWMYCTPPAPIWRRPRSRRRICLNNVLD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.2
2 0.2
3 0.23
4 0.24
5 0.27
6 0.24
7 0.25
8 0.26
9 0.26
10 0.29
11 0.28
12 0.27
13 0.23
14 0.23
15 0.21
16 0.23
17 0.24
18 0.24
19 0.28
20 0.29
21 0.28
22 0.28
23 0.27
24 0.27
25 0.25
26 0.22
27 0.17
28 0.15
29 0.18
30 0.19
31 0.2
32 0.17
33 0.17
34 0.18
35 0.18
36 0.21
37 0.23
38 0.22
39 0.31
40 0.32
41 0.36
42 0.44
43 0.45
44 0.43
45 0.43
46 0.42
47 0.37
48 0.46
49 0.5
50 0.42
51 0.44
52 0.45
53 0.47
54 0.53
55 0.5
56 0.46
57 0.38
58 0.41
59 0.43
60 0.49
61 0.44
62 0.43
63 0.46
64 0.42
65 0.4
66 0.38
67 0.32
68 0.25
69 0.23
70 0.18
71 0.13
72 0.1
73 0.1
74 0.08
75 0.06
76 0.03
77 0.03
78 0.03
79 0.02
80 0.02
81 0.04
82 0.05
83 0.06
84 0.07
85 0.08
86 0.11
87 0.13
88 0.15
89 0.16
90 0.16
91 0.16
92 0.17
93 0.18
94 0.18
95 0.2
96 0.19
97 0.2
98 0.24
99 0.26
100 0.32
101 0.39
102 0.42
103 0.48
104 0.55
105 0.64
106 0.65
107 0.68
108 0.67
109 0.65
110 0.66
111 0.58
112 0.52
113 0.43
114 0.43
115 0.39
116 0.33
117 0.29
118 0.26
119 0.33
120 0.37
121 0.43
122 0.48
123 0.56
124 0.66
125 0.75
126 0.81
127 0.84
128 0.89
129 0.91
130 0.91
131 0.91
132 0.88