Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5N6ZKR3

Protein Details
Accession A0A5N6ZKR3   
Localization Confidence Medium
Confidence Score 10.3
NoLS Segment(s)
PositionSequenceProtein Nature
108-127ERERRPRPTREGGYRRRDQEBasic
NLS Segment(s)
PositionSequence
108-125ERERRPRPTREGGYRRRD
Subcellular Location(s) mito 14, nucl 6, cyto 4, pero 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR037447  Rps10  
IPR005326  S10_plectin_N  
IPR036388  WH-like_DNA-bd_sf  
IPR036390  WH_DNA-bd_sf  
Pfam View protein in Pfam  
PF03501  S10_plectin  
Amino Acid Sequences MLIPKDDRKKIHEYLFREGVLVAKKDFESKHADIDTKNLYVIKALQSLNSRGYVKTQFSWQYYYYTLTPEGLDYLREWLHLPAEVVPATHIKQQRSHAPPRGMMGGEERERRPRPTREGGYRRRDQEKEGGAPGEFAPNFRGGFGRGRGAPSS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.61
2 0.62
3 0.56
4 0.49
5 0.42
6 0.36
7 0.33
8 0.29
9 0.22
10 0.19
11 0.19
12 0.23
13 0.24
14 0.23
15 0.26
16 0.26
17 0.31
18 0.31
19 0.33
20 0.29
21 0.33
22 0.33
23 0.25
24 0.25
25 0.19
26 0.17
27 0.16
28 0.18
29 0.15
30 0.16
31 0.16
32 0.18
33 0.21
34 0.23
35 0.23
36 0.25
37 0.24
38 0.19
39 0.23
40 0.24
41 0.23
42 0.22
43 0.25
44 0.26
45 0.27
46 0.3
47 0.27
48 0.25
49 0.24
50 0.25
51 0.21
52 0.18
53 0.16
54 0.14
55 0.13
56 0.11
57 0.11
58 0.08
59 0.08
60 0.07
61 0.08
62 0.08
63 0.08
64 0.09
65 0.08
66 0.08
67 0.08
68 0.08
69 0.07
70 0.09
71 0.08
72 0.07
73 0.08
74 0.09
75 0.1
76 0.14
77 0.17
78 0.17
79 0.22
80 0.26
81 0.34
82 0.39
83 0.46
84 0.49
85 0.49
86 0.48
87 0.46
88 0.45
89 0.36
90 0.3
91 0.26
92 0.24
93 0.25
94 0.28
95 0.28
96 0.34
97 0.36
98 0.42
99 0.46
100 0.47
101 0.51
102 0.57
103 0.64
104 0.67
105 0.75
106 0.78
107 0.8
108 0.8
109 0.79
110 0.77
111 0.7
112 0.64
113 0.62
114 0.59
115 0.54
116 0.5
117 0.45
118 0.36
119 0.36
120 0.32
121 0.3
122 0.23
123 0.19
124 0.19
125 0.2
126 0.2
127 0.19
128 0.2
129 0.15
130 0.21
131 0.23
132 0.27
133 0.26