Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5N7A5S9

Protein Details
Accession A0A5N7A5S9   
Localization Confidence Low
Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
187-210MHNIVSTPKKNKRKAKKAAPGYAVHydrophilic
NLS Segment(s)
PositionSequence
195-204KKNKRKAKKA
Subcellular Location(s) extr 16, plas 4, mito 3, E.R. 3
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MPFVKGGLAQLFNAVSYYGLISSLAVQVAAGGNSASASQGGYFHGQPMPVTCLNRTIDSGEHITDSLGKLQYIPFPTCKETSLPLALRYGVTETVNCTIDNVSDELYHLLEYYVHSDVPMNCRVPTAPLLPPTSSRSDDKAHEGEAVGTELSALGEEGPPYTPITFALQGTLQRSHLHIWTDMNVLMHNIVSTPKKNKRKAKKAAPGYAVAGTAYSVPEFELSFLNGKKKVSDEEKEAAAVAEAAREPWTAGHGTKVVREQPLTFTFHVSWVEGGGGIGWPARGSAASELSGGTGFFSKLFFFVLAASLGAAMALYWERTRRRGWRGDGILGIPSRGKGSVGVMYGNGGKSNGYGGYSASNVSMTGNGGGYGYGGFTAGKKD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.14
2 0.09
3 0.08
4 0.09
5 0.07
6 0.07
7 0.07
8 0.07
9 0.08
10 0.1
11 0.09
12 0.08
13 0.07
14 0.08
15 0.09
16 0.09
17 0.07
18 0.06
19 0.06
20 0.06
21 0.06
22 0.06
23 0.05
24 0.05
25 0.05
26 0.07
27 0.09
28 0.12
29 0.12
30 0.15
31 0.16
32 0.16
33 0.16
34 0.18
35 0.22
36 0.23
37 0.25
38 0.23
39 0.27
40 0.29
41 0.3
42 0.29
43 0.25
44 0.22
45 0.24
46 0.26
47 0.2
48 0.19
49 0.17
50 0.16
51 0.16
52 0.16
53 0.17
54 0.15
55 0.14
56 0.14
57 0.16
58 0.21
59 0.23
60 0.25
61 0.23
62 0.26
63 0.3
64 0.31
65 0.31
66 0.28
67 0.26
68 0.28
69 0.32
70 0.3
71 0.27
72 0.27
73 0.27
74 0.24
75 0.22
76 0.2
77 0.14
78 0.13
79 0.12
80 0.13
81 0.16
82 0.17
83 0.15
84 0.14
85 0.13
86 0.13
87 0.14
88 0.12
89 0.1
90 0.09
91 0.1
92 0.1
93 0.09
94 0.09
95 0.07
96 0.07
97 0.07
98 0.07
99 0.09
100 0.09
101 0.09
102 0.09
103 0.12
104 0.14
105 0.18
106 0.22
107 0.2
108 0.19
109 0.2
110 0.2
111 0.2
112 0.21
113 0.2
114 0.19
115 0.22
116 0.24
117 0.24
118 0.26
119 0.27
120 0.29
121 0.28
122 0.27
123 0.26
124 0.27
125 0.29
126 0.32
127 0.29
128 0.26
129 0.24
130 0.22
131 0.18
132 0.15
133 0.14
134 0.08
135 0.07
136 0.06
137 0.05
138 0.04
139 0.04
140 0.03
141 0.03
142 0.03
143 0.04
144 0.04
145 0.05
146 0.06
147 0.06
148 0.07
149 0.06
150 0.07
151 0.1
152 0.1
153 0.1
154 0.1
155 0.11
156 0.12
157 0.14
158 0.15
159 0.13
160 0.12
161 0.14
162 0.14
163 0.15
164 0.15
165 0.14
166 0.13
167 0.14
168 0.15
169 0.14
170 0.13
171 0.11
172 0.09
173 0.08
174 0.07
175 0.06
176 0.05
177 0.06
178 0.08
179 0.11
180 0.19
181 0.28
182 0.38
183 0.47
184 0.56
185 0.65
186 0.74
187 0.82
188 0.85
189 0.85
190 0.85
191 0.84
192 0.77
193 0.67
194 0.58
195 0.48
196 0.37
197 0.27
198 0.18
199 0.11
200 0.08
201 0.07
202 0.05
203 0.04
204 0.04
205 0.05
206 0.05
207 0.05
208 0.06
209 0.06
210 0.09
211 0.11
212 0.15
213 0.16
214 0.16
215 0.16
216 0.17
217 0.22
218 0.25
219 0.27
220 0.29
221 0.3
222 0.3
223 0.29
224 0.28
225 0.23
226 0.16
227 0.13
228 0.07
229 0.06
230 0.05
231 0.05
232 0.06
233 0.06
234 0.06
235 0.06
236 0.08
237 0.08
238 0.09
239 0.1
240 0.13
241 0.13
242 0.16
243 0.19
244 0.21
245 0.22
246 0.23
247 0.22
248 0.25
249 0.27
250 0.29
251 0.26
252 0.25
253 0.24
254 0.25
255 0.24
256 0.19
257 0.16
258 0.12
259 0.11
260 0.08
261 0.07
262 0.05
263 0.05
264 0.04
265 0.04
266 0.04
267 0.04
268 0.04
269 0.04
270 0.04
271 0.06
272 0.08
273 0.09
274 0.1
275 0.1
276 0.1
277 0.1
278 0.1
279 0.09
280 0.07
281 0.07
282 0.06
283 0.07
284 0.07
285 0.07
286 0.07
287 0.08
288 0.08
289 0.07
290 0.07
291 0.08
292 0.08
293 0.07
294 0.07
295 0.06
296 0.05
297 0.05
298 0.04
299 0.03
300 0.03
301 0.04
302 0.05
303 0.07
304 0.13
305 0.16
306 0.2
307 0.27
308 0.35
309 0.44
310 0.52
311 0.57
312 0.62
313 0.64
314 0.65
315 0.6
316 0.52
317 0.48
318 0.39
319 0.34
320 0.24
321 0.19
322 0.17
323 0.15
324 0.14
325 0.11
326 0.13
327 0.16
328 0.17
329 0.17
330 0.15
331 0.17
332 0.19
333 0.18
334 0.16
335 0.12
336 0.11
337 0.11
338 0.12
339 0.12
340 0.1
341 0.1
342 0.1
343 0.12
344 0.13
345 0.13
346 0.12
347 0.11
348 0.1
349 0.1
350 0.11
351 0.09
352 0.1
353 0.09
354 0.09
355 0.09
356 0.09
357 0.08
358 0.07
359 0.06
360 0.05
361 0.05
362 0.06