Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5N6ZQZ6

Protein Details
Accession A0A5N6ZQZ6   
Localization Confidence Medium
Confidence Score 11
NoLS Segment(s)
PositionSequenceProtein Nature
84-123TQSRSHKGGRIHKRHSNRKNRSSIVFRPHQSKNKKGPKRRBasic
NLS Segment(s)
PositionSequence
88-123SHKGGRIHKRHSNRKNRSSIVFRPHQSKNKKGPKRR
Subcellular Location(s) mito 14.5, mito_nucl 14, nucl 12.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR019434  DUF2423  
Pfam View protein in Pfam  
PF10338  DUF2423  
Amino Acid Sequences MAKSVRASVQKRNRAKLRATVFGPVVDARTERLSAKLQELASQPKPSNEENSDMALGMKDRQEEMKISQTNEDMDIDNGSIKTTQSRSHKGGRIHKRHSNRKNRSSIVFRPHQSKNKKGPKRR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.74
2 0.75
3 0.74
4 0.69
5 0.66
6 0.6
7 0.54
8 0.47
9 0.4
10 0.37
11 0.28
12 0.23
13 0.16
14 0.15
15 0.12
16 0.13
17 0.14
18 0.13
19 0.16
20 0.18
21 0.19
22 0.21
23 0.23
24 0.22
25 0.24
26 0.26
27 0.3
28 0.29
29 0.32
30 0.3
31 0.28
32 0.31
33 0.29
34 0.32
35 0.27
36 0.27
37 0.24
38 0.25
39 0.23
40 0.2
41 0.18
42 0.13
43 0.11
44 0.09
45 0.08
46 0.07
47 0.07
48 0.08
49 0.09
50 0.1
51 0.12
52 0.19
53 0.2
54 0.2
55 0.21
56 0.21
57 0.21
58 0.2
59 0.19
60 0.11
61 0.1
62 0.1
63 0.08
64 0.09
65 0.08
66 0.07
67 0.07
68 0.07
69 0.1
70 0.11
71 0.18
72 0.24
73 0.3
74 0.34
75 0.42
76 0.48
77 0.53
78 0.62
79 0.66
80 0.69
81 0.71
82 0.76
83 0.78
84 0.83
85 0.86
86 0.87
87 0.87
88 0.87
89 0.88
90 0.84
91 0.82
92 0.79
93 0.77
94 0.75
95 0.72
96 0.67
97 0.64
98 0.68
99 0.7
100 0.7
101 0.72
102 0.74
103 0.76