Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5N7AD38

Protein Details
Accession A0A5N7AD38    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
54-74DVYVRSSNRRRDRRLSALKEYHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 13.5, cyto_mito 11.833, cyto 9, cyto_nucl 5.833, extr 2
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MLHILNFGATVRSLQPWVHMRLENSRFSNRICRVVKIYLGVTFGMALHLYFISDVYVRSSNRRRDRRLSALKEYLGG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.12
2 0.18
3 0.22
4 0.27
5 0.29
6 0.3
7 0.3
8 0.38
9 0.42
10 0.42
11 0.4
12 0.39
13 0.36
14 0.36
15 0.43
16 0.37
17 0.42
18 0.37
19 0.36
20 0.37
21 0.37
22 0.36
23 0.28
24 0.26
25 0.18
26 0.17
27 0.15
28 0.11
29 0.09
30 0.08
31 0.06
32 0.06
33 0.04
34 0.04
35 0.04
36 0.04
37 0.04
38 0.04
39 0.05
40 0.05
41 0.06
42 0.08
43 0.13
44 0.14
45 0.22
46 0.3
47 0.4
48 0.5
49 0.6
50 0.64
51 0.69
52 0.77
53 0.8
54 0.83
55 0.8
56 0.79
57 0.76