Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5N7A117

Protein Details
Accession A0A5N7A117    Localization Confidence Medium Confidence Score 12.8
NoLS Segment(s)
PositionSequenceProtein Nature
107-128RFEDQRKRKFEKDKARKSKDSCBasic
NLS Segment(s)
PositionSequence
112-124RKRKFEKDKARKS
Subcellular Location(s) nucl 12, cyto 10, mito 3
Family & Domain DBs
Amino Acid Sequences MPAHPGSAEAWRAARARLRDEPPPRFPIVMTNFMTPQKVQEPADLPSLPEIGWTTTTGFDQEELDHLRRLQYCVFTGSGRFLHLKETTIGEKTMSEQPDENNLLRARFEDQRKRKFEKDKARKSKDSCSPWPVEAWQAAWAASAADVKREPRFPIIITDFLTPQNVKELAGLSSLPETKWTITTGFADKELDNPEELQYCIVNGYAQLDRVERGSIGKEVRVWCEGKKIITWSAHAEAQKIDGTKTTDH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.29
2 0.29
3 0.34
4 0.41
5 0.44
6 0.49
7 0.58
8 0.63
9 0.64
10 0.65
11 0.6
12 0.53
13 0.49
14 0.48
15 0.45
16 0.44
17 0.4
18 0.37
19 0.37
20 0.38
21 0.39
22 0.3
23 0.28
24 0.24
25 0.26
26 0.25
27 0.27
28 0.28
29 0.28
30 0.33
31 0.29
32 0.26
33 0.23
34 0.22
35 0.17
36 0.15
37 0.14
38 0.1
39 0.11
40 0.12
41 0.11
42 0.12
43 0.12
44 0.12
45 0.11
46 0.1
47 0.1
48 0.1
49 0.12
50 0.15
51 0.17
52 0.17
53 0.17
54 0.21
55 0.21
56 0.23
57 0.22
58 0.2
59 0.2
60 0.21
61 0.22
62 0.18
63 0.18
64 0.18
65 0.16
66 0.16
67 0.16
68 0.14
69 0.17
70 0.17
71 0.18
72 0.16
73 0.18
74 0.18
75 0.18
76 0.18
77 0.14
78 0.14
79 0.15
80 0.19
81 0.17
82 0.16
83 0.16
84 0.17
85 0.22
86 0.25
87 0.22
88 0.21
89 0.21
90 0.2
91 0.19
92 0.2
93 0.17
94 0.21
95 0.28
96 0.34
97 0.42
98 0.52
99 0.58
100 0.63
101 0.67
102 0.7
103 0.73
104 0.74
105 0.76
106 0.77
107 0.82
108 0.84
109 0.83
110 0.78
111 0.77
112 0.74
113 0.71
114 0.65
115 0.59
116 0.53
117 0.47
118 0.44
119 0.36
120 0.28
121 0.21
122 0.17
123 0.13
124 0.11
125 0.1
126 0.09
127 0.09
128 0.07
129 0.06
130 0.08
131 0.06
132 0.07
133 0.09
134 0.11
135 0.13
136 0.15
137 0.17
138 0.17
139 0.19
140 0.18
141 0.23
142 0.24
143 0.24
144 0.24
145 0.23
146 0.21
147 0.2
148 0.22
149 0.15
150 0.13
151 0.15
152 0.14
153 0.13
154 0.12
155 0.13
156 0.11
157 0.12
158 0.12
159 0.08
160 0.1
161 0.11
162 0.1
163 0.11
164 0.11
165 0.11
166 0.13
167 0.13
168 0.12
169 0.13
170 0.16
171 0.18
172 0.17
173 0.17
174 0.18
175 0.17
176 0.19
177 0.21
178 0.19
179 0.17
180 0.17
181 0.18
182 0.17
183 0.17
184 0.15
185 0.11
186 0.1
187 0.1
188 0.09
189 0.08
190 0.06
191 0.1
192 0.09
193 0.11
194 0.12
195 0.13
196 0.13
197 0.14
198 0.15
199 0.12
200 0.13
201 0.14
202 0.18
203 0.18
204 0.2
205 0.23
206 0.25
207 0.28
208 0.31
209 0.3
210 0.27
211 0.34
212 0.35
213 0.32
214 0.33
215 0.34
216 0.36
217 0.37
218 0.38
219 0.35
220 0.36
221 0.39
222 0.36
223 0.33
224 0.28
225 0.28
226 0.29
227 0.24
228 0.21
229 0.2