Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5N6ZWG8

Protein Details
Accession A0A5N6ZWG8   
Localization Confidence Low
Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
1-24MSHDKRFARPLRPRSRKHLSKASTHydrophilic
NLS Segment(s)
PositionSequence
9-17RPLRPRSRK
Subcellular Location(s) mito 16, E.R. 5, extr 3, cyto 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR036736  ACP-like_sf  
IPR020806  PKS_PP-bd  
IPR009081  PP-bd_ACP  
Gene Ontology GO:0031177  F:phosphopantetheine binding  
Pfam View protein in Pfam  
PF00550  PP-binding  
PROSITE View protein in PROSITE  
PS50075  CARRIER  
Amino Acid Sequences MSHDKRFARPLRPRSRKHLSKASTLTEAMVLLVQAIVAKILEIFNIPLSDIDAELPMSHYGVDPVVAVELHNWLSSDAKAKVTVFDILQSASLNEFGALVVSRSEDLTSGICQHGAGNAH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.81
2 0.85
3 0.83
4 0.82
5 0.81
6 0.74
7 0.73
8 0.72
9 0.67
10 0.59
11 0.51
12 0.42
13 0.32
14 0.28
15 0.18
16 0.13
17 0.09
18 0.05
19 0.05
20 0.04
21 0.03
22 0.03
23 0.03
24 0.03
25 0.03
26 0.03
27 0.04
28 0.04
29 0.04
30 0.05
31 0.05
32 0.06
33 0.06
34 0.05
35 0.06
36 0.06
37 0.06
38 0.06
39 0.05
40 0.05
41 0.05
42 0.06
43 0.05
44 0.05
45 0.05
46 0.05
47 0.05
48 0.05
49 0.05
50 0.04
51 0.04
52 0.04
53 0.04
54 0.04
55 0.04
56 0.05
57 0.05
58 0.05
59 0.06
60 0.06
61 0.07
62 0.08
63 0.12
64 0.12
65 0.12
66 0.14
67 0.14
68 0.15
69 0.15
70 0.16
71 0.12
72 0.12
73 0.12
74 0.11
75 0.11
76 0.1
77 0.09
78 0.08
79 0.08
80 0.07
81 0.06
82 0.06
83 0.05
84 0.06
85 0.06
86 0.06
87 0.06
88 0.06
89 0.07
90 0.07
91 0.08
92 0.07
93 0.09
94 0.1
95 0.11
96 0.13
97 0.13
98 0.13
99 0.13
100 0.13