Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A5N7A5Z4

Protein Details
Accession A0A5N7A5Z4    Localization Confidence Low Confidence Score 6.9
NoLS Segment(s)
PositionSequenceProtein Nature
45-65TKAKNECKYKSQNKKNTFVKCHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 10, nucl 5, extr 5, cyto 4, pero 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR023112  Antifungal-protein_dom_sf  
IPR022706  Antifungal_prot  
Gene Ontology GO:0050832  P:defense response to fungus  
Pfam View protein in Pfam  
PF11402  Antifungal_prot  
Amino Acid Sequences MHLTTVVLFLFAAMGAVATPIESEAFGLDARAEASTLIKYPGQCTKAKNECKYKSQNKKNTFVKCPSFANKRCTKDGNWCQFDSYSRNVECK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.03
2 0.03
3 0.03
4 0.03
5 0.03
6 0.03
7 0.03
8 0.04
9 0.04
10 0.04
11 0.04
12 0.05
13 0.05
14 0.05
15 0.05
16 0.05
17 0.05
18 0.05
19 0.05
20 0.04
21 0.05
22 0.06
23 0.06
24 0.08
25 0.09
26 0.09
27 0.11
28 0.16
29 0.19
30 0.21
31 0.22
32 0.3
33 0.38
34 0.45
35 0.5
36 0.55
37 0.56
38 0.61
39 0.69
40 0.71
41 0.73
42 0.76
43 0.78
44 0.75
45 0.81
46 0.81
47 0.79
48 0.76
49 0.73
50 0.68
51 0.61
52 0.6
53 0.58
54 0.6
55 0.58
56 0.6
57 0.61
58 0.61
59 0.63
60 0.62
61 0.58
62 0.59
63 0.64
64 0.66
65 0.62
66 0.58
67 0.54
68 0.52
69 0.52
70 0.45
71 0.4
72 0.37