Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A5N7BC07

Protein Details
Accession A0A5N7BC07    Localization Confidence Low Confidence Score 6.7
NoLS Segment(s)
PositionSequenceProtein Nature
88-111GANPSSRLKKRGQREKIFCRMSRFHydrophilic
NLS Segment(s)
Subcellular Location(s) mito_nucl 7.833, mito 7.5, cyto_nucl 7.333, nucl 7, cyto 6.5, extr 4
Family & Domain DBs
PROSITE View protein in PROSITE  
PS51257  PROKAR_LIPOPROTEIN  
Amino Acid Sequences MPSRFPLSGLAGALISLTLQMVSFTHLMTACLCVTTPATSLYLDNGSMSYSYDCPSQRNKEKGNLGCPDRCYRIQYLDLSLCLYIDFGANPSSRLKKRGQREKIFCRMSRFLLTISPL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.11
2 0.06
3 0.04
4 0.04
5 0.03
6 0.03
7 0.04
8 0.04
9 0.07
10 0.07
11 0.07
12 0.09
13 0.09
14 0.1
15 0.1
16 0.12
17 0.09
18 0.09
19 0.09
20 0.08
21 0.09
22 0.09
23 0.1
24 0.09
25 0.1
26 0.1
27 0.1
28 0.11
29 0.1
30 0.09
31 0.09
32 0.08
33 0.07
34 0.07
35 0.07
36 0.07
37 0.07
38 0.08
39 0.11
40 0.11
41 0.14
42 0.2
43 0.27
44 0.34
45 0.39
46 0.41
47 0.45
48 0.52
49 0.53
50 0.53
51 0.5
52 0.46
53 0.43
54 0.43
55 0.4
56 0.37
57 0.35
58 0.32
59 0.28
60 0.29
61 0.29
62 0.28
63 0.28
64 0.25
65 0.24
66 0.21
67 0.19
68 0.15
69 0.11
70 0.1
71 0.06
72 0.05
73 0.05
74 0.05
75 0.08
76 0.09
77 0.1
78 0.15
79 0.23
80 0.25
81 0.29
82 0.37
83 0.42
84 0.53
85 0.63
86 0.69
87 0.72
88 0.8
89 0.85
90 0.87
91 0.87
92 0.81
93 0.78
94 0.72
95 0.66
96 0.61
97 0.53
98 0.44