Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

C5MCB9

Protein Details
Accession C5MCB9    Localization Confidence Medium Confidence Score 14.3
NoLS Segment(s)
PositionSequenceProtein Nature
40-71EINKQSKESQQSKNKKKKKSKPKVRWSEDTVDHydrophilic
NLS Segment(s)
PositionSequence
52-64KNKKKKKSKPKVR
Subcellular Location(s) nucl 25.5, cyto_nucl 15
Family & Domain DBs
InterPro View protein in InterPro  
IPR011107  PPI_Ypi1  
Gene Ontology GO:0005634  C:nucleus  
GO:0004865  F:protein serine/threonine phosphatase inhibitor activity  
GO:0032515  P:negative regulation of phosphoprotein phosphatase activity  
KEGG ctp:CTRG_03711  -  
Pfam View protein in Pfam  
PF07491  PPI_Ypi1  
Amino Acid Sequences MNNQTSRTIVQENNVLRLRPTPEPTASSSSSNQPSDLGEEINKQSKESQQSKNKKKKKSKPKVRWSEDTVDNEHMNKKKTKICCIFHPQRSFDDEEEEEHNHDHNCSSSDDSSSDSSGDEGEPTNNNGNNNNAIPKPNAYEYQPHYENRSKLPPNTQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.39
2 0.35
3 0.3
4 0.33
5 0.35
6 0.34
7 0.36
8 0.34
9 0.34
10 0.37
11 0.41
12 0.42
13 0.39
14 0.37
15 0.34
16 0.36
17 0.39
18 0.36
19 0.32
20 0.27
21 0.25
22 0.24
23 0.23
24 0.18
25 0.13
26 0.16
27 0.18
28 0.25
29 0.24
30 0.22
31 0.24
32 0.28
33 0.36
34 0.4
35 0.46
36 0.5
37 0.61
38 0.71
39 0.79
40 0.82
41 0.84
42 0.88
43 0.88
44 0.89
45 0.9
46 0.91
47 0.91
48 0.94
49 0.94
50 0.91
51 0.87
52 0.81
53 0.76
54 0.7
55 0.63
56 0.54
57 0.46
58 0.39
59 0.33
60 0.32
61 0.28
62 0.26
63 0.25
64 0.26
65 0.29
66 0.32
67 0.41
68 0.45
69 0.45
70 0.49
71 0.56
72 0.61
73 0.63
74 0.65
75 0.57
76 0.51
77 0.51
78 0.46
79 0.37
80 0.33
81 0.25
82 0.22
83 0.23
84 0.22
85 0.19
86 0.17
87 0.17
88 0.13
89 0.13
90 0.11
91 0.1
92 0.1
93 0.11
94 0.14
95 0.14
96 0.15
97 0.15
98 0.17
99 0.17
100 0.16
101 0.15
102 0.11
103 0.11
104 0.1
105 0.1
106 0.08
107 0.07
108 0.09
109 0.1
110 0.13
111 0.18
112 0.19
113 0.2
114 0.21
115 0.23
116 0.25
117 0.26
118 0.27
119 0.24
120 0.25
121 0.25
122 0.26
123 0.28
124 0.27
125 0.28
126 0.27
127 0.34
128 0.36
129 0.43
130 0.45
131 0.42
132 0.46
133 0.51
134 0.52
135 0.51
136 0.56
137 0.53