Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5N7BL44

Protein Details
Accession A0A5N7BL44   
Localization Confidence Low
Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
86-112CDPQWRCREKGNPCKIRKYKDRATGLVHydrophilic
NLS Segment(s)
Subcellular Location(s) extr 17, mito 8
Family & Domain DBs
Amino Acid Sequences MQITTFALLTFTLLSTSLAGGVRPAGSGARPGIPPKAAPAKELLGTYNGECLMSDGQTSAYGICIASDQGPAAKSQQGKAEYQWGCDPQWRCREKGNPCKIRKYKDRATGLVSLNARCY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.08
2 0.07
3 0.08
4 0.09
5 0.08
6 0.08
7 0.08
8 0.09
9 0.08
10 0.08
11 0.08
12 0.07
13 0.07
14 0.09
15 0.11
16 0.12
17 0.13
18 0.15
19 0.17
20 0.18
21 0.17
22 0.2
23 0.28
24 0.26
25 0.25
26 0.26
27 0.26
28 0.26
29 0.26
30 0.22
31 0.14
32 0.15
33 0.14
34 0.13
35 0.11
36 0.09
37 0.08
38 0.09
39 0.08
40 0.07
41 0.07
42 0.05
43 0.06
44 0.06
45 0.06
46 0.05
47 0.04
48 0.04
49 0.04
50 0.04
51 0.04
52 0.04
53 0.05
54 0.05
55 0.05
56 0.06
57 0.06
58 0.07
59 0.08
60 0.11
61 0.11
62 0.13
63 0.19
64 0.2
65 0.21
66 0.22
67 0.3
68 0.27
69 0.28
70 0.3
71 0.27
72 0.25
73 0.3
74 0.32
75 0.31
76 0.41
77 0.41
78 0.4
79 0.46
80 0.54
81 0.58
82 0.66
83 0.69
84 0.7
85 0.73
86 0.82
87 0.82
88 0.83
89 0.82
90 0.81
91 0.79
92 0.79
93 0.81
94 0.73
95 0.7
96 0.68
97 0.61
98 0.59
99 0.52