Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

D8FGF6

Protein Details
Accession D8FGF6    Localization Confidence Medium Confidence Score 10.6
NoLS Segment(s)
PositionSequenceProtein Nature
56-94APEKRPRVKGRIKKPSRRKKSKRRKSRHHQEQQQPASQDBasic
NLS Segment(s)
PositionSequence
58-82EKRPRVKGRIKKPSRRKKSKRRKSR
Subcellular Location(s) cyto_nucl 10.5, cyto 10, nucl 9, mito 3, E.R. 2
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
KEGG ago:AGOS_AFL072CA  -  
Amino Acid Sequences MVDEPDTPPPQGVDALADPEVTLVHSRPQLQESKETRLDLLAEQNWETLEKITYVAPEKRPRVKGRIKKPSRRKKSKRRKSRHHQEQQQPASQDGLFHGLLLGSFIGAALAEFVLAKFK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.13
2 0.15
3 0.14
4 0.14
5 0.12
6 0.11
7 0.11
8 0.09
9 0.09
10 0.07
11 0.11
12 0.14
13 0.16
14 0.18
15 0.22
16 0.26
17 0.27
18 0.36
19 0.36
20 0.41
21 0.42
22 0.4
23 0.37
24 0.32
25 0.31
26 0.22
27 0.23
28 0.17
29 0.16
30 0.15
31 0.15
32 0.14
33 0.14
34 0.13
35 0.09
36 0.08
37 0.07
38 0.07
39 0.07
40 0.09
41 0.12
42 0.15
43 0.2
44 0.27
45 0.31
46 0.37
47 0.43
48 0.45
49 0.51
50 0.57
51 0.61
52 0.65
53 0.71
54 0.74
55 0.79
56 0.86
57 0.88
58 0.9
59 0.92
60 0.92
61 0.92
62 0.94
63 0.95
64 0.95
65 0.95
66 0.95
67 0.95
68 0.96
69 0.96
70 0.95
71 0.95
72 0.93
73 0.92
74 0.87
75 0.82
76 0.71
77 0.61
78 0.52
79 0.42
80 0.33
81 0.23
82 0.21
83 0.14
84 0.13
85 0.12
86 0.09
87 0.09
88 0.09
89 0.08
90 0.04
91 0.04
92 0.04
93 0.03
94 0.03
95 0.03
96 0.03
97 0.03
98 0.03
99 0.04