Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5N7BMI7

Protein Details
Accession A0A5N7BMI7   
Localization Confidence Low
Confidence Score 6.3
NoLS Segment(s)
PositionSequenceProtein Nature
79-110KRLCDGCKPVRRKNRVYIICSKNPKHKQRQGKHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 18, mito_nucl 13.166, cyto_mito 10.166, nucl 7, cyto_nucl 4.666
Family & Domain DBs
InterPro View protein in InterPro  
IPR000473  Ribosomal_L36  
IPR035977  Ribosomal_L36_sp  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00444  Ribosomal_L36  
PROSITE View protein in PROSITE  
PS00828  RIBOSOMAL_L36  
Amino Acid Sequences MVSLRSLIAPSTGLFRQFLRKPLAGGFFSRSFSQLTTLSLTSGLRALRSGKQEAGNVSVASTVRQLDQIRGMKTRSSVKRLCDGCKPVRRKNRVYIICSKNPKHKQRQGK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.16
2 0.17
3 0.25
4 0.27
5 0.33
6 0.34
7 0.34
8 0.34
9 0.37
10 0.41
11 0.34
12 0.32
13 0.32
14 0.27
15 0.28
16 0.27
17 0.24
18 0.19
19 0.18
20 0.19
21 0.15
22 0.14
23 0.15
24 0.15
25 0.14
26 0.14
27 0.13
28 0.1
29 0.12
30 0.1
31 0.08
32 0.09
33 0.11
34 0.14
35 0.17
36 0.19
37 0.19
38 0.21
39 0.22
40 0.22
41 0.22
42 0.19
43 0.16
44 0.14
45 0.12
46 0.1
47 0.09
48 0.09
49 0.07
50 0.07
51 0.11
52 0.11
53 0.11
54 0.18
55 0.23
56 0.24
57 0.26
58 0.27
59 0.24
60 0.27
61 0.36
62 0.34
63 0.37
64 0.39
65 0.41
66 0.48
67 0.51
68 0.51
69 0.5
70 0.52
71 0.54
72 0.6
73 0.64
74 0.66
75 0.73
76 0.78
77 0.77
78 0.79
79 0.8
80 0.79
81 0.78
82 0.78
83 0.76
84 0.77
85 0.79
86 0.75
87 0.75
88 0.77
89 0.81
90 0.82