Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

D8FGB7

Protein Details
Accession D8FGB7   
Localization Confidence Medium
Confidence Score 11.3
NoLS Segment(s)
PositionSequenceProtein Nature
183-209RGLSHSGKPLPKKKRSRSPSAPEGPPPBasic
NLS Segment(s)
PositionSequence
188-213SGKPLPKKKRSRSPSAPEGPPPAKKA
Subcellular Location(s) nucl 10mito 10mito_nucl 10
Family & Domain DBs
InterPro View protein in InterPro  
IPR006735  Rtf2  
Gene Ontology GO:0005634  C:nucleus  
GO:1902979  P:mitotic DNA replication termination  
GO:0071171  P:site-specific DNA replication termination at RTS1 barrier  
KEGG ago:AGOS_ADL356CA  -  
Pfam View protein in Pfam  
PF04641  Rtf2  
Amino Acid Sequences MGNDGGTINRSKNLAVAAVRGANVAADDNVQEYNWQSQWTSCRLSGKPLQLPVVGDCKGNIINKEALLEWLLDRQERGAGKPRPEFRHLRRRADMVELHNLVAEGDAGILRCPVGDATLGQSKGRFVYLASCGDVMPQKLQQQVSQCAVCGKAYDPLDVVLINPRAADEHAALRDRMRVLVERGLSHSGKPLPKKKRSRSPSAPEGPPPAKKAATRVGTD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.2
2 0.18
3 0.19
4 0.19
5 0.2
6 0.2
7 0.18
8 0.16
9 0.12
10 0.11
11 0.1
12 0.07
13 0.06
14 0.07
15 0.08
16 0.08
17 0.08
18 0.08
19 0.09
20 0.13
21 0.13
22 0.14
23 0.13
24 0.17
25 0.21
26 0.25
27 0.27
28 0.25
29 0.31
30 0.31
31 0.37
32 0.41
33 0.44
34 0.45
35 0.44
36 0.43
37 0.38
38 0.39
39 0.34
40 0.33
41 0.26
42 0.21
43 0.18
44 0.17
45 0.19
46 0.2
47 0.19
48 0.17
49 0.18
50 0.18
51 0.19
52 0.17
53 0.15
54 0.13
55 0.12
56 0.09
57 0.11
58 0.11
59 0.1
60 0.1
61 0.1
62 0.13
63 0.13
64 0.15
65 0.22
66 0.26
67 0.32
68 0.39
69 0.46
70 0.47
71 0.52
72 0.58
73 0.57
74 0.63
75 0.65
76 0.66
77 0.61
78 0.59
79 0.55
80 0.52
81 0.47
82 0.39
83 0.38
84 0.31
85 0.28
86 0.25
87 0.23
88 0.18
89 0.13
90 0.1
91 0.03
92 0.03
93 0.03
94 0.03
95 0.03
96 0.03
97 0.03
98 0.03
99 0.03
100 0.03
101 0.03
102 0.03
103 0.04
104 0.07
105 0.11
106 0.11
107 0.11
108 0.12
109 0.12
110 0.12
111 0.12
112 0.09
113 0.06
114 0.09
115 0.12
116 0.13
117 0.13
118 0.13
119 0.12
120 0.14
121 0.15
122 0.12
123 0.11
124 0.13
125 0.15
126 0.18
127 0.19
128 0.21
129 0.24
130 0.27
131 0.29
132 0.27
133 0.24
134 0.22
135 0.22
136 0.19
137 0.15
138 0.12
139 0.14
140 0.15
141 0.15
142 0.15
143 0.14
144 0.15
145 0.14
146 0.13
147 0.13
148 0.13
149 0.12
150 0.12
151 0.11
152 0.12
153 0.12
154 0.14
155 0.1
156 0.13
157 0.16
158 0.18
159 0.18
160 0.18
161 0.22
162 0.2
163 0.2
164 0.18
165 0.19
166 0.2
167 0.25
168 0.26
169 0.24
170 0.26
171 0.3
172 0.29
173 0.26
174 0.29
175 0.3
176 0.34
177 0.42
178 0.49
179 0.54
180 0.64
181 0.74
182 0.79
183 0.84
184 0.86
185 0.87
186 0.89
187 0.87
188 0.88
189 0.86
190 0.8
191 0.75
192 0.75
193 0.7
194 0.65
195 0.59
196 0.54
197 0.49
198 0.46
199 0.47
200 0.48