Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5N7BC91

Protein Details
Accession A0A5N7BC91   
Localization Confidence Low
Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
36-59MIKVKDRTTNPKKRDPNPSKNGDVHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 9plas 9, pero 4, E.R. 2, golg 2
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MKEKGRGGGSMTFIIIILFFSYEKFGFCIVRTGVSMIKVKDRTTNPKKRDPNPSKNGDVSRPVQRPV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.16
2 0.12
3 0.08
4 0.05
5 0.05
6 0.05
7 0.05
8 0.07
9 0.07
10 0.08
11 0.08
12 0.09
13 0.09
14 0.1
15 0.13
16 0.11
17 0.12
18 0.12
19 0.12
20 0.12
21 0.14
22 0.16
23 0.13
24 0.19
25 0.19
26 0.2
27 0.26
28 0.3
29 0.38
30 0.46
31 0.56
32 0.56
33 0.65
34 0.73
35 0.73
36 0.8
37 0.8
38 0.8
39 0.79
40 0.8
41 0.75
42 0.74
43 0.71
44 0.64
45 0.6
46 0.54
47 0.55