Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5N7BMK4

Protein Details
Accession A0A5N7BMK4    Localization Confidence Low Confidence Score 6.8
NoLS Segment(s)
PositionSequenceProtein Nature
4-23TSPPPPTTTRMPSKKPNLVIHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 15, nucl 6, cyto 6, cyto_nucl 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR017850  Alkaline_phosphatase_core_sf  
IPR000917  Sulfatase_N  
Gene Ontology GO:0008484  F:sulfuric ester hydrolase activity  
Pfam View protein in Pfam  
PF00884  Sulfatase  
CDD cd16150  sulfatase_like  
Amino Acid Sequences MPVTSPPPPTTTRMPSKKPNLVIFMPDQLRYDSLSCTSNSKTSFLKTPNISYFAARGTLFTNCFTQASVCSQSRCSMFTGTYPHVSGHRSLENLIKPWEPNLFRSLKENGYHVACLAPRGDTFAPGVTELSVDEYGFLETPEFVPRFSGGRADNDGSRNERRSSSGNSSIWGRLFYKGLRNAAEASDYDDAAVRSALRWLQCPPADQPWVLFLPLIFPHCPFQVEEPYFSLYDRDGILAPEASGQKTGHEPRYMRVIRERYGTGRATGEMWRELKATYYGMISRLDEQFGRVVAQIDELGLWDETVTMFFTDHGEYLGDHGLIEKWPSGLSDSLVHEPLIIAGGGLPQGQVYTGMAEMVDLVPTVLELCGIPEQFPHNGRSLVPVLRDPGLGHREYAFSEGGFLTTEEPLLEQAPYPYDIKAALQHEDTMLVGKAVSIRSLEWTYIYRLYEPAELYHRHHDPEEMHNLAAEPKYVPVARMLEAEVLRWLVASSDLLPWTKDTRFPEVTLKSPKEQLQERLRKRDSEEDN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.64
2 0.7
3 0.77
4 0.8
5 0.8
6 0.77
7 0.73
8 0.66
9 0.63
10 0.56
11 0.54
12 0.48
13 0.42
14 0.37
15 0.32
16 0.31
17 0.28
18 0.26
19 0.2
20 0.2
21 0.21
22 0.2
23 0.23
24 0.25
25 0.28
26 0.28
27 0.29
28 0.29
29 0.31
30 0.38
31 0.38
32 0.44
33 0.42
34 0.48
35 0.5
36 0.51
37 0.48
38 0.42
39 0.39
40 0.32
41 0.31
42 0.24
43 0.2
44 0.17
45 0.2
46 0.2
47 0.2
48 0.2
49 0.19
50 0.19
51 0.19
52 0.18
53 0.16
54 0.2
55 0.25
56 0.26
57 0.26
58 0.28
59 0.31
60 0.32
61 0.31
62 0.28
63 0.24
64 0.22
65 0.24
66 0.29
67 0.28
68 0.29
69 0.28
70 0.27
71 0.27
72 0.28
73 0.27
74 0.25
75 0.25
76 0.23
77 0.24
78 0.3
79 0.31
80 0.32
81 0.32
82 0.3
83 0.27
84 0.28
85 0.34
86 0.3
87 0.29
88 0.32
89 0.32
90 0.3
91 0.35
92 0.37
93 0.34
94 0.34
95 0.33
96 0.3
97 0.29
98 0.29
99 0.24
100 0.23
101 0.18
102 0.18
103 0.16
104 0.14
105 0.11
106 0.17
107 0.17
108 0.15
109 0.16
110 0.16
111 0.16
112 0.15
113 0.15
114 0.1
115 0.1
116 0.08
117 0.1
118 0.09
119 0.08
120 0.08
121 0.08
122 0.09
123 0.09
124 0.09
125 0.06
126 0.06
127 0.08
128 0.12
129 0.12
130 0.11
131 0.12
132 0.14
133 0.15
134 0.15
135 0.19
136 0.15
137 0.19
138 0.23
139 0.24
140 0.26
141 0.26
142 0.29
143 0.29
144 0.33
145 0.33
146 0.31
147 0.3
148 0.3
149 0.32
150 0.36
151 0.38
152 0.41
153 0.38
154 0.37
155 0.38
156 0.37
157 0.34
158 0.29
159 0.23
160 0.17
161 0.18
162 0.19
163 0.24
164 0.26
165 0.29
166 0.28
167 0.28
168 0.27
169 0.26
170 0.25
171 0.18
172 0.17
173 0.15
174 0.13
175 0.12
176 0.12
177 0.11
178 0.1
179 0.1
180 0.06
181 0.06
182 0.07
183 0.1
184 0.09
185 0.11
186 0.12
187 0.18
188 0.2
189 0.22
190 0.23
191 0.26
192 0.28
193 0.26
194 0.24
195 0.21
196 0.21
197 0.18
198 0.15
199 0.09
200 0.1
201 0.11
202 0.13
203 0.11
204 0.11
205 0.13
206 0.13
207 0.14
208 0.12
209 0.14
210 0.2
211 0.21
212 0.21
213 0.21
214 0.23
215 0.22
216 0.21
217 0.19
218 0.1
219 0.11
220 0.09
221 0.09
222 0.07
223 0.07
224 0.08
225 0.07
226 0.07
227 0.09
228 0.09
229 0.09
230 0.1
231 0.1
232 0.1
233 0.15
234 0.19
235 0.19
236 0.23
237 0.24
238 0.23
239 0.34
240 0.34
241 0.3
242 0.34
243 0.34
244 0.32
245 0.34
246 0.34
247 0.26
248 0.3
249 0.29
250 0.23
251 0.19
252 0.18
253 0.16
254 0.17
255 0.16
256 0.14
257 0.14
258 0.14
259 0.14
260 0.13
261 0.13
262 0.12
263 0.11
264 0.09
265 0.09
266 0.09
267 0.1
268 0.1
269 0.1
270 0.11
271 0.12
272 0.12
273 0.11
274 0.11
275 0.1
276 0.1
277 0.1
278 0.08
279 0.09
280 0.08
281 0.08
282 0.07
283 0.07
284 0.06
285 0.06
286 0.06
287 0.05
288 0.04
289 0.04
290 0.04
291 0.04
292 0.04
293 0.04
294 0.04
295 0.04
296 0.04
297 0.06
298 0.06
299 0.06
300 0.07
301 0.07
302 0.06
303 0.08
304 0.08
305 0.07
306 0.06
307 0.07
308 0.07
309 0.07
310 0.08
311 0.06
312 0.06
313 0.06
314 0.07
315 0.08
316 0.07
317 0.08
318 0.11
319 0.13
320 0.15
321 0.15
322 0.15
323 0.13
324 0.13
325 0.11
326 0.09
327 0.06
328 0.04
329 0.03
330 0.04
331 0.04
332 0.04
333 0.04
334 0.03
335 0.03
336 0.04
337 0.04
338 0.04
339 0.04
340 0.04
341 0.04
342 0.04
343 0.04
344 0.05
345 0.04
346 0.04
347 0.03
348 0.03
349 0.03
350 0.03
351 0.04
352 0.03
353 0.03
354 0.03
355 0.05
356 0.07
357 0.07
358 0.08
359 0.09
360 0.11
361 0.15
362 0.17
363 0.18
364 0.18
365 0.19
366 0.19
367 0.23
368 0.24
369 0.22
370 0.22
371 0.21
372 0.21
373 0.21
374 0.21
375 0.17
376 0.21
377 0.23
378 0.21
379 0.21
380 0.2
381 0.2
382 0.2
383 0.22
384 0.16
385 0.11
386 0.12
387 0.11
388 0.11
389 0.1
390 0.1
391 0.09
392 0.08
393 0.09
394 0.07
395 0.07
396 0.08
397 0.08
398 0.08
399 0.07
400 0.08
401 0.09
402 0.11
403 0.12
404 0.11
405 0.11
406 0.12
407 0.12
408 0.17
409 0.18
410 0.18
411 0.18
412 0.19
413 0.18
414 0.18
415 0.17
416 0.13
417 0.11
418 0.08
419 0.07
420 0.07
421 0.09
422 0.09
423 0.1
424 0.09
425 0.1
426 0.14
427 0.16
428 0.16
429 0.15
430 0.17
431 0.2
432 0.23
433 0.24
434 0.2
435 0.2
436 0.22
437 0.24
438 0.22
439 0.22
440 0.24
441 0.26
442 0.29
443 0.35
444 0.35
445 0.34
446 0.34
447 0.35
448 0.33
449 0.38
450 0.41
451 0.35
452 0.32
453 0.3
454 0.3
455 0.29
456 0.26
457 0.2
458 0.13
459 0.12
460 0.17
461 0.17
462 0.17
463 0.18
464 0.21
465 0.21
466 0.22
467 0.22
468 0.23
469 0.23
470 0.23
471 0.19
472 0.17
473 0.15
474 0.14
475 0.12
476 0.07
477 0.08
478 0.09
479 0.09
480 0.12
481 0.14
482 0.15
483 0.16
484 0.18
485 0.22
486 0.23
487 0.28
488 0.29
489 0.36
490 0.38
491 0.4
492 0.47
493 0.47
494 0.53
495 0.57
496 0.57
497 0.53
498 0.56
499 0.58
500 0.57
501 0.59
502 0.61
503 0.62
504 0.68
505 0.73
506 0.78
507 0.77
508 0.74
509 0.73