Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5N7ANQ0

Protein Details
Accession A0A5N7ANQ0    Localization Confidence Low Confidence Score 7.6
NoLS Segment(s)
PositionSequenceProtein Nature
14-38SLTTGFPYKKDLKRHQRDKHTDEGGHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 17, nucl 7, cyto 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR013087  Znf_C2H2_type  
Amino Acid Sequences MHVRPFKCDVAGCSLTTGFPYKKDLKRHQRDKHTDEGGAYYCPYSWCNYSRPQREQNGRKGMRHDNYMRHMKKVHYGFGQWPRETE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.26
2 0.23
3 0.22
4 0.24
5 0.16
6 0.16
7 0.22
8 0.29
9 0.35
10 0.45
11 0.54
12 0.61
13 0.71
14 0.8
15 0.83
16 0.85
17 0.88
18 0.84
19 0.81
20 0.73
21 0.62
22 0.52
23 0.45
24 0.35
25 0.26
26 0.21
27 0.12
28 0.09
29 0.09
30 0.09
31 0.09
32 0.1
33 0.12
34 0.15
35 0.23
36 0.32
37 0.4
38 0.46
39 0.51
40 0.58
41 0.66
42 0.71
43 0.72
44 0.74
45 0.7
46 0.66
47 0.65
48 0.66
49 0.59
50 0.6
51 0.55
52 0.52
53 0.56
54 0.64
55 0.59
56 0.55
57 0.54
58 0.49
59 0.52
60 0.49
61 0.48
62 0.41
63 0.43
64 0.47
65 0.54
66 0.6